Clone RE02351 Report

Search the DGRC for RE02351

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:23
Well:51
Vector:pFlc-1
Associated Gene/TranscriptCG17134-RA
Protein status:RE02351.pep: gold
Preliminary Size:1176
Sequenced Size:1276

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17134 2001-12-14 Blastp of sequenced clone
CG17134 2002-01-01 Sim4 clustering to Release 2
CG17134 2003-01-01 Sim4 clustering to Release 3
CG17134 2008-04-29 Release 5.5 accounting
CG17134 2008-08-15 Release 5.9 accounting
CG17134 2008-12-18 5.12 accounting

Clone Sequence Records

RE02351.complete Sequence

1276 bp (1276 high quality bases) assembled on 2001-12-14

GenBank Submission: AY070911

> RE02351.complete
ACAGTCGAATTTCAGCCGCAGACATGAGACAGTTGTTAGTTTTATTGGTG
CTTGTCGGGATTGGCCATTCCGCTGCCAAGTTGAATCGCGTCCAGCTCCA
AGTGAACAAGAATTTCACCAAGACCCATGGCAGTGTTAAGGCCGAGAAGA
CCGTGCTGGCATCGAAGTACTCCTTTTTGGCGGAGACCTCTTTCAGTGTC
AGTTCGTCGGGTGCCACCGAAAACCTGCACAATTCCATGAACAATGAGTA
CTACGGCGTGATTGCTATCGGAACGCCTGAGCAGAGATTCAACATTCTGT
TCGACACGGGATCGGCCAATCTGTGGGTTCCAAGTGCAAGTTGCCCGGCT
TCGAATACCGCGTGCCAGAGGCACAACAAATACGATTCTTCGGCATCCAG
CACTTATGTGGCCAATGGTGAGGAGTTCGCCATCGAATACGGAACTGGTA
GTCTGTCGGGTTTCCTGTCCAACGACATTGTGACCATAGCGGGAATCAGC
ATTCAGAATCAGACATTCGGCGAAGCACTCAGCGAGCCGGGTACAACCTT
CGTGGATGCTCCTTTTGCTGGAATCCTGGGACTGGCCTTCAGCGCGATTG
CCGTCGATGGAGTGACTCCGCCGTTCGACAACATGATCTCCCAGGGACTG
CTCGATGAACCAGTTATCTCCTTCTATCTCAAGCGACAGGGAACCGCTGT
GCGCGGTGGAGAACTGATCCTGGGCGGTATTGACTCGAGTCTCTATAGGG
GAAGCCTCACCTATGTGCCCGTTTCCGTTCCTGCCTACTGGCAGTTCAAG
GTGAACACCATCAAGACCAATGGCACTTTGCTGTGCAACGGATGCCAAGC
CATCGCCGATACGGGCACCTCCTTAATCGCAGTTCCACTGGCCGCTTACA
GGAAGATCAATCGCCAGCTGGGCGCCACCGATAATGACGGTGAGGCATTC
GTGAGGTGCGGCCGAGTCTCATCCCTGCCCAAGGTCAACCTGAATATCGG
TGGTACTGTCTTCACCCTGGCACCAAGGGATTATATAGTCAAGGTAACGC
AGAATGGCCAAACCTACTGCATGTCCGCCTTCACCTACATGGAGGGACTA
AGCTTCTGGATTCTGGGTGATGTCTTTATTGGCAAGTTCTACACGGTTTT
CGACAAGGGCAACGAAAGGATTGGTTTCGCCAGGGTGGCGGATTATTAAC
ATAACGTTGTTATCGAAAAGGAAATAACTAAGAGAAATACATGCAATACA
TAAAATCTAGAAAAAAAAAAAAAAAA

RE02351.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:38:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG17134-RA 1259 CG17134-RA 1..1259 1..1259 6295 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:04:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10819457..10820715 1..1259 6160 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:25:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:04:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10820710..10821968 1..1259 6295 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:05:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10820710..10821968 1..1259 6295 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:04:30 has no hits.

RE02351.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:05:27 Download gff for RE02351.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10819457..10820715 1..1260 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:46:37 Download gff for RE02351.complete
Subject Subject Range Query Range Percent Splice Strand
CG17134-RA 1..1176 24..1199 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:02:14 Download gff for RE02351.complete
Subject Subject Range Query Range Percent Splice Strand
CG17134-RA 1..1176 24..1199 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:06:19 Download gff for RE02351.complete
Subject Subject Range Query Range Percent Splice Strand
CG17134-RA 1..1176 24..1199 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:26:44 Download gff for RE02351.complete
Subject Subject Range Query Range Percent Splice Strand
CG17134-RA 1..1176 24..1199 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:15:04 Download gff for RE02351.complete
Subject Subject Range Query Range Percent Splice Strand
CG17134-RA 1..1176 24..1199 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:28:55 Download gff for RE02351.complete
Subject Subject Range Query Range Percent Splice Strand
CG17134-RA 1..1259 1..1259 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:02:14 Download gff for RE02351.complete
Subject Subject Range Query Range Percent Splice Strand
CG17134-RA 1..1259 1..1259 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:06:19 Download gff for RE02351.complete
Subject Subject Range Query Range Percent Splice Strand
CG17134-RA 6..1263 1..1258 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:26:44 Download gff for RE02351.complete
Subject Subject Range Query Range Percent Splice Strand
CG17134-RA 1..1259 1..1259 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:15:04 Download gff for RE02351.complete
Subject Subject Range Query Range Percent Splice Strand
CG17134-RA 6..1263 1..1258 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:05:27 Download gff for RE02351.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10820710..10821968 1..1260 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:05:27 Download gff for RE02351.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10820710..10821968 1..1260 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:05:27 Download gff for RE02351.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10820710..10821968 1..1260 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:06:19 Download gff for RE02351.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10820710..10821968 1..1260 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:02:33 Download gff for RE02351.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10820710..10821968 1..1260 99   Plus

RE02351.hyp Sequence

Translation from 2 to 1198

> RE02351.hyp
SRISAADMRQLLVLLVLVGIGHSAAKLNRVQLQVNKNFTKTHGSVKAEKT
VLASKYSFLAETSFSVSSSGATENLHNSMNNEYYGVIAIGTPEQRFNILF
DTGSANLWVPSASCPASNTACQRHNKYDSSASSTYVANGEEFAIEYGTGS
LSGFLSNDIVTIAGISIQNQTFGEALSEPGTTFVDAPFAGILGLAFSAIA
VDGVTPPFDNMISQGLLDEPVISFYLKRQGTAVRGGELILGGIDSSLYRG
SLTYVPVSVPAYWQFKVNTIKTNGTLLCNGCQAIADTGTSLIAVPLAAYR
KINRQLGATDNDGEAFVRCGRVSSLPKVNLNIGGTVFTLAPRDYIVKVTQ
NGQTYCMSAFTYMEGLSFWILGDVFIGKFYTVFDKGNERIGFARVADY*

RE02351.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:22:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG17134-PA 391 CG17134-PA 1..391 8..398 2008 100 Plus
CG6508-PA 423 CG6508-PA 2..387 7..395 1140 57.9 Plus
Bace-PB 372 CG13095-PB 3..372 9..396 1023 54.4 Plus
Bace-PA 372 CG13095-PA 3..372 9..396 1023 54.4 Plus
CG33128-PA 405 CG33128-PA 1..405 8..396 1005 49.3 Plus

RE02351.pep Sequence

Translation from 23 to 1198

> RE02351.pep
MRQLLVLLVLVGIGHSAAKLNRVQLQVNKNFTKTHGSVKAEKTVLASKYS
FLAETSFSVSSSGATENLHNSMNNEYYGVIAIGTPEQRFNILFDTGSANL
WVPSASCPASNTACQRHNKYDSSASSTYVANGEEFAIEYGTGSLSGFLSN
DIVTIAGISIQNQTFGEALSEPGTTFVDAPFAGILGLAFSAIAVDGVTPP
FDNMISQGLLDEPVISFYLKRQGTAVRGGELILGGIDSSLYRGSLTYVPV
SVPAYWQFKVNTIKTNGTLLCNGCQAIADTGTSLIAVPLAAYRKINRQLG
ATDNDGEAFVRCGRVSSLPKVNLNIGGTVFTLAPRDYIVKVTQNGQTYCM
SAFTYMEGLSFWILGDVFIGKFYTVFDKGNERIGFARVADY*

RE02351.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19728-PA 390 GF19728-PA 1..389 1..389 1443 70.2 Plus
Dana\GF19727-PA 449 GF19727-PA 1..380 1..388 1093 55.1 Plus
Dana\GF14369-PA 371 GF14369-PA 2..371 1..389 1054 55 Plus
Dana\GF15184-PA 403 GF15184-PA 81..403 66..389 961 56.5 Plus
Dana\GF11236-PA 388 GF11236-PA 22..385 19..386 903 48.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23678-PA 392 GG23678-PA 1..392 1..391 1806 88 Plus
Dere\GG23677-PA 427 GG23677-PA 17..387 14..388 1122 58.6 Plus
Dere\GG24067-PA 372 GG24067-PA 18..372 19..389 1059 56.9 Plus
Dere\GG24793-PA 404 GG24793-PA 1..404 1..389 1021 50.1 Plus
Dere\GG22202-PA 395 GG22202-PA 24..395 19..389 927 48.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:20:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24623-PA 374 GH24623-PA 2..374 1..389 1023 54.1 Plus
Dgri\GH11416-PA 400 GH11416-PA 16..397 17..386 970 49.7 Plus
Dgri\GH24344-PA 373 GH24344-PA 15..373 17..389 967 52.9 Plus
Dgri\GH21578-PA 388 GH21578-PA 57..385 64..386 893 52.9 Plus
Dgri\GH11415-PA 416 GH11415-PA 25..413 12..386 777 44.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG17134-PA 391 CG17134-PA 1..391 1..391 2008 100 Plus
CG6508-PA 423 CG6508-PA 7..387 4..388 1139 58.1 Plus
Bace-PB 372 CG13095-PB 3..372 2..389 1023 54.4 Plus
Bace-PA 372 CG13095-PA 3..372 2..389 1023 54.4 Plus
CG33128-PA 405 CG33128-PA 1..405 1..389 1005 49.3 Plus
CG5863-PA 395 CG5863-PA 24..395 19..389 920 49.6 Plus
cathD-PC 392 CG1548-PC 7..389 4..386 884 47.3 Plus
cathD-PB 392 CG1548-PB 7..389 4..386 884 47.3 Plus
cathD-PA 392 CG1548-PA 7..389 4..386 884 47.3 Plus
Pgcl-PA 407 CG13374-PA 15..379 7..388 827 47.5 Plus
CG31926-PB 410 CG31926-PB 12..406 4..386 729 42.1 Plus
CG31926-PA 410 CG31926-PA 12..406 4..386 729 42.1 Plus
CG10104-PA 404 CG10104-PA 77..400 68..386 721 44.9 Plus
CG17283-PA 465 CG17283-PA 105..459 25..386 693 42.9 Plus
CG31928-PB 418 CG31928-PB 13..415 5..386 652 40.8 Plus
CG31928-PA 418 CG31928-PA 13..415 5..386 652 40.8 Plus
CG5860-PA 370 CG5860-PA 2..368 1..387 635 36.6 Plus
CG31661-PA 393 CG31661-PA 7..390 4..386 516 33.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11124-PA 373 GI11124-PA 2..373 1..389 1047 53.7 Plus
Dmoj\GI11125-PA 371 GI11125-PA 2..371 1..389 1030 53.2 Plus
Dmoj\GI14567-PA 402 GI14567-PA 19..402 18..389 1029 52.1 Plus
Dmoj\GI19550-PA 387 GI19550-PA 21..384 19..386 848 49.2 Plus
Dmoj\GI11126-PA 421 GI11126-PA 18..385 18..389 848 45 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26637-PA 387 GL26637-PA 1..387 1..391 1565 74.2 Plus
Dper\GL15694-PA 401 GL15694-PA 1..401 1..390 1040 49.8 Plus
Dper\GL25647-PA 373 GL25647-PA 3..373 1..389 1038 53.5 Plus
Dper\GL23572-PA 393 GL23572-PA 1..393 4..389 1001 51.1 Plus
Dper\GL11239-PA 388 GL11239-PA 19..385 16..386 893 47.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:20:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14340-PA 387 GA14340-PA 1..387 1..391 1570 74.5 Plus
Dpse\GA25369-PA 373 GA25369-PA 3..373 1..389 1038 53.5 Plus
Dpse\GA22213-PA 373 GA22213-PA 3..373 1..389 1038 53.7 Plus
Dpse\GA17303-PA 401 GA17303-PA 1..401 1..390 1033 49.5 Plus
Dpse\GA19187-PA 393 GA19187-PA 1..393 4..389 1004 51.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18746-PA 392 GM18746-PA 1..392 1..391 1883 95.4 Plus
Dsec\GM12869-PA 372 GM12869-PA 16..372 17..389 1050 56 Plus
Dsec\GM18741-PA 378 GM18741-PA 3..345 19..391 1040 54.1 Plus
Dsec\GM16820-PA 405 GM16820-PA 1..405 1..389 981 49.3 Plus
Dsec\GM15229-PA 395 GM15229-PA 24..395 19..389 953 49.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:20:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23736-PA 564 GD23736-PA 260..564 88..391 1552 95.4 Plus
Dsim\GD23736-PA 564 GD23736-PA 1..278 1..291 1221 87.3 Plus
Dsim\GD23735-PA 404 GD23735-PA 9..371 23..391 1138 58.8 Plus
Dsim\GD23099-PA 405 GD23099-PA 1..405 1..389 982 49.3 Plus
Dsim\GD19155-PA 395 GD19155-PA 24..395 19..389 950 49.6 Plus
Dsim\GD10217-PA 324 GD10217-PA 1..321 72..386 896 53.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:20:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15983-PA 372 GJ15983-PA 2..372 1..389 1043 54.2 Plus
Dvir\GJ15982-PA 374 GJ15982-PA 2..374 1..389 1035 53.5 Plus
Dvir\GJ17077-PA 404 GJ17077-PA 82..404 66..389 1023 58.6 Plus
Dvir\GJ21122-PA 391 GJ21122-PA 3..388 2..386 868 48.5 Plus
Dvir\GJ15984-PA 423 GJ15984-PA 10..386 5..388 850 45.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:20:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19045-PA 411 GK19045-PA 1..411 1..389 1060 50.6 Plus
Dwil\GK24836-PA 372 GK24836-PA 2..372 1..389 1059 54.8 Plus
Dwil\GK11645-PA 388 GK11645-PA 7..388 4..389 954 50.5 Plus
Dwil\GK21682-PA 389 GK21682-PA 1..386 1..386 926 48.2 Plus
Dwil\GK15196-PA 415 GK15196-PA 6..411 2..386 863 45.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:20:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18491-PA 392 GE18491-PA 1..392 1..391 1810 91.6 Plus
Dyak\GE18490-PA 403 GE18490-PA 2..367 18..388 1133 58.3 Plus
Dyak\GE10927-PA 372 GE10927-PA 16..372 17..389 1058 57.4 Plus
Dyak\GE17593-PA 404 GE17593-PA 1..404 1..389 975 49.1 Plus
Dyak\GE10129-PA 396 GE10129-PA 24..396 19..389 941 49.5 Plus