Clone RE02355 Report

Search the DGRC for RE02355

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:23
Well:55
Vector:pFlc-1
Associated Gene/TranscriptMrgBP-RA
Protein status:RE02355.pep: gold
Preliminary Size:606
Sequenced Size:766

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13746 2002-01-01 Sim4 clustering to Release 2
CG13746 2003-01-01 Sim4 clustering to Release 3
CG13746 2003-08-02 Blastp of sequenced clone
MrgBP 2008-04-29 Release 5.5 accounting
MrgBP 2008-08-15 Release 5.9 accounting
MrgBP 2008-12-18 5.12 accounting

Clone Sequence Records

RE02355.complete Sequence

766 bp (766 high quality bases) assembled on 2003-08-02

GenBank Submission: AY070912

> RE02355.complete
AATATTCGCGCAGAAAAACATACAATACGTATCAGTTTTTAGTTCCATGC
GCTCTGCAAAATGATGGCCAAGGACAAGGGTCTGGCTGTGGCCGGAACGG
CGGCCCCCTTACCGGCCGCCCTCGACCACGAGTGGTCCGCCGAGGAAGAG
CTGCAGCTGTTCCATGCAATGGAAGGCCTGCGCCCGGTGGGCATCAACAA
GCACTTCTACATGTCCTGCATTGTCCAGCGTCTGTCCAAGTCGCTGAACC
GTGAAATGCCCAGCGAGCTGATCTGGCGCCACCTGGGCACCATGTACAAG
CTGAAGGAACTGGACGATCTGGAGTCGCTGCCCTTTCCCAACGAGGAGCG
CGAGTTCAGCCTGCCGGAGCAGGATTACGGAACGCTACAGACCAAAAAGA
CGGTGGAAGTGCATGCGAACGAGGAGGCTGCAGAGGCACAGTCGGCCCCT
CCAACAGCAGAGACCAATGGCAAAGCTCCACCTGCAACCAAAACGCCGGT
ACCGACGAATTCCACCAAGGACGGCGACAAAAAGCCCGTCGCCAAGCCCC
AGGAGCAGCTGCCCAAGCGTCCGGCCAAGCGCACACGCGGCTCCATGTCC
AACGAGTCCATCAGCCCCTCCACTACGCCGCCGCCGGTGCAGAGCAACAA
GCGCCGTCGCATATAGGTGACCCCCGCCCGAAACTGACGATTGTTGATCC
GTTTTAGCTCATTAGTTTTACTGTACTCTAATAAAAGGATTTATTGTTCG
AAAAAAAAAAAAAAAA

RE02355.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:12:34
Subject Length Description Subject Range Query Range Score Percent Strand
MrgBP-RA 755 MrgBP-RA 6..755 1..750 3720 99.7 Plus
CG13751-RA 377 CG13751-RA 323..377 753..699 260 98.1 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:39:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4788446..4788920 475..1 2345 99.6 Minus
chr2R 21145070 chr2R 4788119..4788395 750..474 1355 99.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:25:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:39:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8900893..8901367 475..1 2360 99.8 Minus
2R 25286936 2R 8900563..8900842 753..474 1385 99.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:36:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8902092..8902566 475..1 2360 99.7 Minus
2R 25260384 2R 8901762..8902041 753..474 1385 99.6 Minus
Blast to na_te.dros performed on 2019-03-16 18:39:36 has no hits.

RE02355.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:40:33 Download gff for RE02355.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4788119..4788393 476..750 99 <- Minus
chr2R 4788446..4788920 1..475 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:46:38 Download gff for RE02355.complete
Subject Subject Range Query Range Percent Splice Strand
MrgBP-RA 1..606 61..666 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:52:10 Download gff for RE02355.complete
Subject Subject Range Query Range Percent Splice Strand
MrgBP-RA 1..606 61..666 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:15:45 Download gff for RE02355.complete
Subject Subject Range Query Range Percent Splice Strand
MrgBP-RA 1..606 61..666 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:21:23 Download gff for RE02355.complete
Subject Subject Range Query Range Percent Splice Strand
MrgBP-RA 1..606 61..666 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:45:30 Download gff for RE02355.complete
Subject Subject Range Query Range Percent Splice Strand
MrgBP-RA 1..606 61..666 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:37:11 Download gff for RE02355.complete
Subject Subject Range Query Range Percent Splice Strand
MrgBP-RA 6..755 1..750 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:52:10 Download gff for RE02355.complete
Subject Subject Range Query Range Percent Splice Strand
MrgBP-RA 6..755 1..750 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:15:45 Download gff for RE02355.complete
Subject Subject Range Query Range Percent Splice Strand
MrgBP-RA 9..758 1..750 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:21:23 Download gff for RE02355.complete
Subject Subject Range Query Range Percent Splice Strand
MrgBP-RA 6..755 1..750 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:45:30 Download gff for RE02355.complete
Subject Subject Range Query Range Percent Splice Strand
MrgBP-RA 9..758 1..750 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:40:33 Download gff for RE02355.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8900566..8900840 476..750 99 <- Minus
2R 8900893..8901367 1..475 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:40:33 Download gff for RE02355.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8900566..8900840 476..750 99 <- Minus
2R 8900893..8901367 1..475 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:40:33 Download gff for RE02355.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8900566..8900840 476..750 99 <- Minus
2R 8900893..8901367 1..475 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:15:45 Download gff for RE02355.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4788071..4788345 476..750 99 <- Minus
arm_2R 4788398..4788872 1..475 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:58:04 Download gff for RE02355.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8901765..8902039 476..750 99 <- Minus
2R 8902092..8902566 1..475 99   Minus

RE02355.pep Sequence

Translation from 60 to 665

> RE02355.pep
MMAKDKGLAVAGTAAPLPAALDHEWSAEEELQLFHAMEGLRPVGINKHFY
MSCIVQRLSKSLNREMPSELIWRHLGTMYKLKELDDLESLPFPNEEREFS
LPEQDYGTLQTKKTVEVHANEEAAEAQSAPPTAETNGKAPPATKTPVPTN
STKDGDKKPVAKPQEQLPKRPAKRTRGSMSNESISPSTTPPPVQSNKRRR
I*

RE02355.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:31:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12563-PA 204 GF12563-PA 1..204 1..201 804 77.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:31:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10614-PA 201 GG10614-PA 1..201 1..201 1002 93 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:31:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22690-PA 183 GH22690-PA 6..183 24..201 631 69.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:27
Subject Length Description Subject Range Query Range Score Percent Strand
MrgBP-PA 201 CG13746-PA 1..201 1..201 1048 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:31:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20617-PA 190 GI20617-PA 13..190 24..201 647 71.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:31:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10410-PA 200 GL10410-PA 1..200 1..201 784 76.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:31:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12503-PA 200 GA12503-PA 1..200 1..201 783 76.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:31:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20658-PA 201 GM20658-PA 1..201 1..201 1022 96 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:31:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10131-PA 201 GD10131-PA 1..201 1..201 1039 97.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:31:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21057-PA 181 GJ21057-PA 5..181 24..201 629 69.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:31:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20940-PA 200 GK20940-PA 14..200 23..201 603 67.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:31:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22753-PA 201 GE22753-PA 1..201 1..201 916 91 Plus

RE02355.hyp Sequence

Translation from 60 to 665

> RE02355.hyp
MMAKDKGLAVAGTAAPLPAALDHEWSAEEELQLFHAMEGLRPVGINKHFY
MSCIVQRLSKSLNREMPSELIWRHLGTMYKLKELDDLESLPFPNEEREFS
LPEQDYGTLQTKKTVEVHANEEAAEAQSAPPTAETNGKAPPATKTPVPTN
STKDGDKKPVAKPQEQLPKRPAKRTRGSMSNESISPSTTPPPVQSNKRRR
I*

RE02355.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
MrgBP-PA 201 CG13746-PA 1..201 1..201 1048 100 Plus