Clone RE02926 Report

Search the DGRC for RE02926

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:29
Well:26
Vector:pFlc-1
Associated Gene/TranscriptCG12310-RA
Protein status:RE02926.pep: gold
Preliminary Size:537
Sequenced Size:484

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12310 2001-12-17 Blastp of sequenced clone
CG12310 2002-01-01 Sim4 clustering to Release 2
CG12310 2003-01-01 Sim4 clustering to Release 3
CG12310 2008-04-29 Release 5.5 accounting
CG12310 2008-08-15 Release 5.9 accounting
CG12310 2008-12-18 5.12 accounting

Clone Sequence Records

RE02926.complete Sequence

484 bp (484 high quality bases) assembled on 2001-12-17

GenBank Submission: AY070923

> RE02926.complete
AAAGCAGTTTTCGCGATAACTTCTTAGACTCAACTTCAAAATGCGTTCCC
TGATTCTTGTCGCTCTTTTGGCCTTCTTGGCTGTTGGCTTTGTGGCTGCC
CGTCCAGCTGAGGATGAGGAGTCCTCCGCTGCCGTGGTTGAGAATGCCGA
TGAGGATTCGACTAGCAATGATGCGGAGAGCACCGAAGCCACTGATGCGG
AGGAATCTTCTGATGATGAGGAGACGACTGAAGAGTCTGGTGATGCCGCT
GACGAATCCAGCGATGATGCCGATGAGGATGAGACAACCACTGCAGCTTC
GGCCAAGAAGCAGATCCGTCCCTTCTGGCCCAGGTTCGGAGGTCATGGTC
CAGTTGTGATCAGGCGTCACCCTAGTCTTGTCTAGGTCAAAGCCCTATAG
TCTTGATTGCTTAACTATTCCTTTCTATTTTCTAAATAAAAAATGTTATC
TTTAACTCAAACTAAAAAAAAAAAAAAAAAAAAA

RE02926.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG12310-RA 549 CG12310-RA 1..468 1..468 2340 100 Plus
nc_12651.a 484 nc_12651.a 1..233 101..333 1165 100 Plus
CG13461-RA 414 CG13461-RA 1..87 41..127 255 86.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:54:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15040386..15040849 463..1 2255 99.6 Minus
chr3L 24539361 chr3L 15042434..15042523 127..38 270 86.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:26:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:54:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15050338..15050805 468..1 2340 100 Minus
3L 28110227 3L 15052389..15052478 127..38 270 86.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15043438..15043905 468..1 2340 100 Minus
3L 28103327 3L 15045489..15045578 127..38 270 86.6 Minus
Blast to na_te.dros performed 2019-03-16 20:54:04
Subject Length Description Subject Range Query Range Score Percent Strand
412 7567 412 412 7567bp 2038..2089 433..383 104 69.2 Minus

RE02926.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:54:42 Download gff for RE02926.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15040386..15040849 1..463 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:47:13 Download gff for RE02926.complete
Subject Subject Range Query Range Percent Splice Strand
CG12310-RA 1..345 41..385 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:08 Download gff for RE02926.complete
Subject Subject Range Query Range Percent Splice Strand
CG12310-RA 1..345 41..385 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:30:01 Download gff for RE02926.complete
Subject Subject Range Query Range Percent Splice Strand
CG12310-RA 1..345 41..385 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:37:42 Download gff for RE02926.complete
Subject Subject Range Query Range Percent Splice Strand
CG12310-RA 1..345 41..385 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:58:54 Download gff for RE02926.complete
Subject Subject Range Query Range Percent Splice Strand
CG12310-RA 1..345 41..385 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:08:22 Download gff for RE02926.complete
Subject Subject Range Query Range Percent Splice Strand
CG12310-RA 1..463 1..463 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:08 Download gff for RE02926.complete
Subject Subject Range Query Range Percent Splice Strand
CG12310-RA 1..463 1..463 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:30:01 Download gff for RE02926.complete
Subject Subject Range Query Range Percent Splice Strand
CG12310-RA 2..464 1..463 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-04 17:07:16 Download gff for RE02926.complete
Subject Subject Range Query Range Percent Splice Strand
CG12310-RA 1..463 1..463 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:58:54 Download gff for RE02926.complete
Subject Subject Range Query Range Percent Splice Strand
CG12310-RA 2..464 1..463 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:54:42 Download gff for RE02926.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15050343..15050805 1..463 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:54:42 Download gff for RE02926.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15050343..15050805 1..463 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:54:42 Download gff for RE02926.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15050343..15050805 1..463 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:30:01 Download gff for RE02926.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15043443..15043905 1..463 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:20:33 Download gff for RE02926.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15043443..15043905 1..463 100   Minus

RE02926.pep Sequence

Translation from 40 to 384

> RE02926.pep
MRSLILVALLAFLAVGFVAARPAEDEESSAAVVENADEDSTSNDAESTEA
TDAEESSDDEETTEESGDAADESSDDADEDETTTAASAKKQIRPFWPRFG
GHGPVVIRRHPSLV*

RE02926.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:17:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10749-PA 115 GF10749-PA 1..107 1..109 212 56 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:17:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13692-PA 118 GG13692-PA 1..113 1..114 424 76.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG12310-PA 114 CG12310-PA 1..114 1..114 568 100 Plus
CG13461-PA 137 CG13461-PA 1..133 1..111 192 38 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:17:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25877-PA 128 GL25877-PA 1..125 1..114 202 39.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:17:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23647-PA 128 GA23647-PA 1..125 1..114 202 40 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:17:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24511-PA 130 GM24511-PA 1..129 1..114 171 38.4 Plus
Dsec\GM24512-PA 41 GM24512-PA 1..39 1..39 168 92.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:17:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12583-PA 115 GD12583-PA 1..114 1..114 412 88.6 Plus
Dsim\GD12582-PA 130 GD12582-PA 1..129 1..114 186 41.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:17:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17407-PA 109 GK17407-PA 1..104 1..110 173 40.9 Plus
Dwil\GK17406-PA 112 GK17406-PA 1..108 1..113 170 46.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:17:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19986-PA 116 GE19986-PA 1..113 1..110 397 80.5 Plus
Dyak\GE19985-PA 129 GE19985-PA 1..67 1..72 147 54.2 Plus

RE02926.hyp Sequence

Translation from 40 to 384

> RE02926.hyp
MRSLILVALLAFLAVGFVAARPAEDEESSAAVVENADEDSTSNDAESTEA
TDAEESSDDEETTEESGDAADESSDDADEDETTTAASAKKQIRPFWPRFG
GHGPVVIRRHPSLV*

RE02926.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:09:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG12310-PA 114 CG12310-PA 1..114 1..114 568 100 Plus
CG13461-PA 137 CG13461-PA 1..133 1..111 192 38 Plus