Clone RE03238 Report

Search the DGRC for RE03238

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:32
Well:38
Vector:pFlc-1
Associated Gene/TranscriptCG30195-RA
Protein status:RE03238.pep: gold
Preliminary Size:945
Sequenced Size:587

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30195 2001-12-14 Blastp of sequenced clone
CG13513 2002-01-01 Sim4 clustering to Release 2
CG30195 2003-01-01 Sim4 clustering to Release 3
CG30195 2008-04-29 Release 5.5 accounting
CG30195 2008-08-15 Release 5.9 accounting
CG30195 2008-12-18 5.12 accounting

Clone Sequence Records

RE03238.complete Sequence

587 bp (587 high quality bases) assembled on 2001-12-14

GenBank Submission: AY070933

> RE03238.complete
AGTCACCGATCGTTCTCGCTGGAACTCGCATCATGACCGTGGACGAACCG
CAGATTGTGGCCATCATTGTCAGCCACAAGCCACAAGTGGGATACCTGAA
GGAGGAGCCCACCTGGATCCGTTGTCCTTCGTGTGAGAAGTCTGGAACCA
GTTTGGTGCAACTGGAGTTGGTCACTTGCCTGCAGAGATTTCTGGGATTC
ACAAAACTTTGTAAAAAATGGTCTGGCCGCCAGGACATCAATCACTATTG
TTCACACTGCGGTTGCTTCATTGGAAGATTTGTGCCCATCAGCTGCATGG
AACGATGCATTTCGAGATCAGCCCGTAAACAGGCGGCCGTGGATGATATG
ACCCTGAAGACACGACCCAAGGATTGCGCTGAAAGGGCCCAGAAATCCAG
GGAGAAAGTTCTGGCCAGCAGGGAGAAGAAGAGAGCAGAGAAGGCAGCCA
AGGATATGGACAAATCTCAGACGCAAATAGCAGTACACCAATAAATAAAA
GCATATTTTTTTACTTACTTTTTGTGTACAGAACCGTCAATAAAACAAGA
GAGAATGCTACGTGCTAATGCAAAAAAAAAAAAAAAA

RE03238.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:12:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG30195-RA 726 CG30195-RA 109..682 1..574 2870 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:26:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18533177..18533537 571..211 1760 99.2 Minus
chr2R 21145070 chr2R 18533597..18533807 211..1 980 97.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:26:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:26:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22646613..22646976 574..211 1820 100 Minus
2R 25286936 2R 22647031..22647241 211..1 1055 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:53:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22647812..22648175 574..211 1820 100 Minus
2R 25260384 2R 22648230..22648440 211..1 1055 100 Minus
Blast to na_te.dros performed on 2019-03-15 19:26:50 has no hits.

RE03238.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:27:33 Download gff for RE03238.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18533177..18533536 212..571 99 <- Minus
chr2R 18533597..18533807 1..211 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:47:28 Download gff for RE03238.complete
Subject Subject Range Query Range Percent Splice Strand
CG30195-RA 1..462 33..494 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:41:18 Download gff for RE03238.complete
Subject Subject Range Query Range Percent Splice Strand
CG30195-RA 1..462 33..494 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:51:50 Download gff for RE03238.complete
Subject Subject Range Query Range Percent Splice Strand
CG30195-RA 1..462 33..494 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:35:20 Download gff for RE03238.complete
Subject Subject Range Query Range Percent Splice Strand
CG30195-RA 1..462 33..494 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:18:41 Download gff for RE03238.complete
Subject Subject Range Query Range Percent Splice Strand
CG30195-RA 1..462 33..494 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:54:56 Download gff for RE03238.complete
Subject Subject Range Query Range Percent Splice Strand
CG30195-RA 1..571 1..571 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:41:18 Download gff for RE03238.complete
Subject Subject Range Query Range Percent Splice Strand
CG30195-RA 1..571 1..571 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:51:50 Download gff for RE03238.complete
Subject Subject Range Query Range Percent Splice Strand
CG30195-RA 5..575 1..571 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:35:21 Download gff for RE03238.complete
Subject Subject Range Query Range Percent Splice Strand
CG30195-RA 1..571 1..571 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:18:41 Download gff for RE03238.complete
Subject Subject Range Query Range Percent Splice Strand
CG30195-RA 5..575 1..571 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:27:33 Download gff for RE03238.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22646616..22646975 212..571 100 <- Minus
2R 22647031..22647241 1..211 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:27:33 Download gff for RE03238.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22646616..22646975 212..571 100 <- Minus
2R 22647031..22647241 1..211 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:27:33 Download gff for RE03238.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22646616..22646975 212..571 100 <- Minus
2R 22647031..22647241 1..211 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:51:50 Download gff for RE03238.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18534121..18534480 212..571 100 <- Minus
arm_2R 18534536..18534746 1..211 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:02:36 Download gff for RE03238.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22647815..22648174 212..571 100 <- Minus
2R 22648230..22648440 1..211 100   Minus

RE03238.hyp Sequence

Translation from 2 to 493

> RE03238.hyp
SPIVLAGTRIMTVDEPQIVAIIVSHKPQVGYLKEEPTWIRCPSCEKSGTS
LVQLELVTCLQRFLGFTKLCKKWSGRQDINHYCSHCGCFIGRFVPISCME
RCISRSARKQAAVDDMTLKTRPKDCAERAQKSREKVLASREKKRAEKAAK
DMDKSQTQIAVHQ*

RE03238.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:00:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG30195-PA 153 CG30195-PA 1..153 11..163 812 100 Plus
CG30196-PA 147 CG30196-PA 16..145 23..147 203 34.6 Plus

RE03238.pep Sequence

Translation from 32 to 493

> RE03238.pep
MTVDEPQIVAIIVSHKPQVGYLKEEPTWIRCPSCEKSGTSLVQLELVTCL
QRFLGFTKLCKKWSGRQDINHYCSHCGCFIGRFVPISCMERCISRSARKQ
AAVDDMTLKTRPKDCAERAQKSREKVLASREKKRAEKAAKDMDKSQTQIA
VHQ*

RE03238.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:42:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13581-PA 153 GF13581-PA 1..153 1..153 674 79.7 Plus
Dana\GF13577-PA 125 GF13577-PA 14..119 13..114 184 37.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:42:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21775-PA 153 GG21775-PA 1..153 1..153 777 94.8 Plus
Dere\GG21770-PA 147 GG21770-PA 16..109 13..101 198 43.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:42:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22106-PA 147 GH22106-PA 1..136 1..135 450 65.4 Plus
Dgri\GH12597-PA 147 GH12597-PA 1..136 1..135 450 65.4 Plus
Dgri\GH22102-PA 144 GH22102-PA 19..111 13..100 200 46.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG30195-PA 153 CG30195-PA 1..153 1..153 812 100 Plus
CG30196-PA 147 CG30196-PA 16..145 13..137 203 34.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:42:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19241-PA 151 GI19241-PA 1..146 1..145 459 56.2 Plus
Dmoj\GI19237-PA 142 GI19237-PA 17..110 13..101 203 45.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:42:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10718-PA 179 GL10718-PA 1..148 1..148 558 69.6 Plus
Dper\GL10714-PA 148 GL10714-PA 20..112 13..100 192 41.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:42:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15720-PA 179 GA15720-PA 1..148 1..148 558 69.6 Plus
Dpse\GA24453-PA 148 GA24453-PA 20..112 13..100 192 41.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:42:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15626-PA 153 GM15626-PA 1..153 1..153 795 98 Plus
Dsec\GM13598-PA 78 GM13598-PA 1..59 1..59 307 98.3 Plus
Dsec\GM15618-PA 147 GM15618-PA 16..109 13..101 198 43.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:42:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25115-PA 153 GD25115-PA 1..153 1..153 799 98 Plus
Dsim\GD25112-PA 147 GD25112-PA 16..109 13..101 198 43.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:42:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20317-PA 155 GJ20317-PA 1..140 1..139 498 65 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:42:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21854-PA 152 GK21854-PA 1..140 1..140 527 68.6 Plus
Dwil\GK21850-PA 149 GK21850-PA 17..112 13..105 191 43.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:42:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11850-PA 153 GE11850-PA 1..153 1..153 773 94.1 Plus
Dyak\GE11845-PA 147 GE11845-PA 16..109 13..101 192 42.6 Plus