Clone RE03721 Report

Search the DGRC for RE03721

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:37
Well:21
Vector:pFlc-1
Associated Gene/TranscriptCG14270-RA
Protein status:RE03721.pep: gold
Preliminary Size:576
Sequenced Size:786

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14270 2002-01-01 Sim4 clustering to Release 2
CG14270 2002-01-18 Blastp of sequenced clone
CG14270 2003-01-01 Sim4 clustering to Release 3
CG14270 2008-04-29 Release 5.5 accounting
CG14270 2008-08-15 Release 5.9 accounting
CG14270 2008-12-18 5.12 accounting

Clone Sequence Records

RE03721.complete Sequence

786 bp (786 high quality bases) assembled on 2002-01-18

GenBank Submission: AY089566

> RE03721.complete
GAGCTGTTTTTTTGATTTGATAACACTAGCACTTTAATTCCACCTGGTTT
TTCGGCTTTTTCCAAATTGATCACTGAAAACCCGCCAGGAGATGCAGTTC
CTCCGCGTGGGTGGTCGTATAACGGCACTGCGTCAGAGATTGACCGATCG
AATTCAGATGCCGGAGCGCTTCAAGGGCACGTTCGTGGAGAAGTGGGTGC
AGTATTGGAACGGCCTGGTCAGGGACTACACAGAGGTGGCAGTGGGTGTT
GTGCGAGAATCCTACACGAAGCCGAAAAAGGCGCTTCTCTATGGAACGGG
AATGCTGTTCATGTACCAAGCCAATCTGAAGAATCCCGGCGAGGAGGCCT
TTATGACTCTGCTAAGGGGTGCCACAAATCGAATGATCACAGTGCCGGTA
GAACTTCAGAATCCCGTGTCCGCCGACTATCTGCTAACCTTGGAGAGGGC
GATCAATCAAAAGAAACTGCGTCTCCTTTCTCTCGGCATCTGCACGATCC
TTTGGGTGGATCTATACGACGAGGACGACTGCACCTATCCGGCCATCTGT
GAATATACCAACGTGGGCGTCTTCAACTTCCACGAACGGATCATCGATGT
GGGATTTTGGAATCAATACTGGCGACTCAAATGGAAGATGCGCAACTATG
ATGTCAACTACCTGTGATCCCACACCACAAAGCTTAACGCTTTCGTTATC
CTTAAGACCGTGTTTGCTGCTTAAGTCAATCGAGGGAGAATATACCAATA
TATGTATGTTTTTAGTACATGAAAAAAAAAAAAAAA

RE03721.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:28:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG14270-RA 775 CG14270-RA 1..772 2..773 3860 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:17:06
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 3378135..3378901 770..2 3750 99.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:26:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:17:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 3484603..3485374 773..2 3860 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 3492701..3493472 773..2 3860 100 Minus
Blast to na_te.dros performed on 2019-03-15 16:17:04 has no hits.

RE03721.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:17:47 Download gff for RE03721.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 3378134..3378901 1..771 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:47:47 Download gff for RE03721.complete
Subject Subject Range Query Range Percent Splice Strand
CG14270-RA 1..576 92..667 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:44:55 Download gff for RE03721.complete
Subject Subject Range Query Range Percent Splice Strand
CG14270-RA 1..576 92..667 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:59:07 Download gff for RE03721.complete
Subject Subject Range Query Range Percent Splice Strand
CG14270-RA 1..576 92..667 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:13:06 Download gff for RE03721.complete
Subject Subject Range Query Range Percent Splice Strand
CG14270-RA 1..576 92..667 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:32:40 Download gff for RE03721.complete
Subject Subject Range Query Range Percent Splice Strand
CG14270-RA 1..576 92..667 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:09:26 Download gff for RE03721.complete
Subject Subject Range Query Range Percent Splice Strand
CG14270-RA 1..770 2..771 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:44:54 Download gff for RE03721.complete
Subject Subject Range Query Range Percent Splice Strand
CG14270-RA 1..770 2..771 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:59:07 Download gff for RE03721.complete
Subject Subject Range Query Range Percent Splice Strand
CG14270-RA 4..774 1..771 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:13:07 Download gff for RE03721.complete
Subject Subject Range Query Range Percent Splice Strand
CG14270-RA 1..770 2..771 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:32:40 Download gff for RE03721.complete
Subject Subject Range Query Range Percent Splice Strand
CG14270-RA 4..774 1..771 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:17:47 Download gff for RE03721.complete
Subject Subject Range Query Range Percent Splice Strand
X 3484605..3485374 1..771 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:17:47 Download gff for RE03721.complete
Subject Subject Range Query Range Percent Splice Strand
X 3484605..3485374 1..771 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:17:47 Download gff for RE03721.complete
Subject Subject Range Query Range Percent Splice Strand
X 3484605..3485374 1..771 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:59:07 Download gff for RE03721.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 3378638..3379407 1..771 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:47:24 Download gff for RE03721.complete
Subject Subject Range Query Range Percent Splice Strand
X 3492703..3493472 1..771 99   Minus

RE03721.hyp Sequence

Translation from 91 to 666

> RE03721.hyp
MQFLRVGGRITALRQRLTDRIQMPERFKGTFVEKWVQYWNGLVRDYTEVA
VGVVRESYTKPKKALLYGTGMLFMYQANLKNPGEEAFMTLLRGATNRMIT
VPVELQNPVSADYLLTLERAINQKKLRLLSLGICTILWVDLYDEDDCTYP
AICEYTNVGVFNFHERIIDVGFWNQYWRLKWKMRNYDVNYL*

RE03721.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:16:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG14270-PA 191 CG14270-PA 1..191 1..191 1023 100 Plus

RE03721.pep Sequence

Translation from 91 to 666

> RE03721.pep
MQFLRVGGRITALRQRLTDRIQMPERFKGTFVEKWVQYWNGLVRDYTEVA
VGVVRESYTKPKKALLYGTGMLFMYQANLKNPGEEAFMTLLRGATNRMIT
VPVELQNPVSADYLLTLERAINQKKLRLLSLGICTILWVDLYDEDDCTYP
AICEYTNVGVFNFHERIIDVGFWNQYWRLKWKMRNYDVNYL*

RE03721.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:47:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21784-PA 191 GF21784-PA 1..191 1..191 829 79.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:47:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18579-PA 191 GG18579-PA 1..191 1..191 959 92.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:47:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12398-PA 191 GH12398-PA 1..191 1..191 712 66 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG14270-PA 191 CG14270-PA 1..191 1..191 1023 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:47:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14336-PA 191 GI14336-PA 1..191 1..191 730 68.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:47:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12874-PA 191 GL12874-PA 1..191 1..191 751 71.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:47:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12871-PA 191 GA12871-PA 1..191 1..191 760 71.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:47:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12722-PA 191 GM12722-PA 1..191 1..191 956 93.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:47:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16328-PA 198 GD16328-PA 1..182 1..182 924 94.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:47:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19390-PA 191 GJ19390-PA 1..191 1..191 755 70.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:47:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10145-PA 191 GK10145-PA 1..191 1..191 756 70.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:47:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16890-PA 191 GE16890-PA 1..191 1..191 988 95.8 Plus