Clone RE03817 Report

Search the DGRC for RE03817

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:38
Well:17
Vector:pFlc-1
Associated Gene/TranscriptCG14329-RA
Protein status:RE03817.pep: validated full length
Preliminary Size:906
Sequenced Size:1188

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14329 2001-12-14 Blastp of sequenced clone
CG14329 2002-01-01 Sim4 clustering to Release 2
CG14329 2003-01-01 Sim4 clustering to Release 3
CG14329 2008-04-29 Release 5.5 accounting

Clone Sequence Records

RE03817.complete Sequence

1188 bp (1188 high quality bases) assembled on 2001-12-14

GenBank Submission: AY070941

> RE03817.complete
AGTTTGTGCTCATCCCGCCGAGCGTGCAGAAGTCTTTCAGCAATAGAATC
GCGTTTTCAATATGAAACTGTTTCTTCTACTCCTTCTGGGAGCCTTGGGC
TATTCGTTGGCCTATCCGCGCACCTATAGTTACGAGTATCCCCGCCGAAG
GGCCTACTCCACATCGTATTCCGGGAATTCGTATAGCTCTTTGGCCGGTC
GGAAGGCTAGGGAAGAAAGTACCACCAGCAAATCGGACAAGGAGAATGCC
AAGTTTGCTGGTGCTTCCAATCAGGAATTGGATGAAACCGGTGACGAACG
CACACTGCTGCTTAAAAAGAAGCTCAAGAGGTTGGCCAGGCCCTACCTAG
GAGGATATGGTGGATATGGCGGATATGGTGGATATGGCGGATATGGAGGA
TACGGCGGTGGTCCCTGCTCCCCGTTTGGTCGCGATGCTCGAGGTGGTCA
GAATCAGAAGGATCCCGCTGAACAGGGTCGCTTTCTGTTCGACGTGAATG
TGGTGAAAGTATATCCCGGTGGATGTCGCGGCTATGGAGGAGGTGGTTTG
GGTGGAGGTCTTCTGTCTGATCCTCTTCCACCTGTACAACCCATTCCAGT
GCCAGTGCGTCCGTACGCACCATTTGCCACCTGGCTATCGCTCTTTGCTC
CAGGAATTCTTAACTCGGCCGTGGTGCCTGGTGTTCCAGTCAGAGATCCT
CTAAGAGATCCAGTTCGTCCTGCTGGAGATGCGCAGAGCGATCCTGAAGT
GGATCCCAACTATGCGGCACCTCCGCCAGTAAGGCGACCTGTTCCGAATC
GTGTGTACTACGATTCTGCGGGAGCGGTAAGTTCATTAACTTTAATATAT
TGCGAATTTTATATTTTTATTTATTGTTAATAACTTTTTTCATGCCAGCC
TCCTGTGACACCTGCTCAACTAGTTGGAGGCGTGGCCACCACAGTAAACG
GAATCATTCAGCAGTTGACTGGACAAGTGCAGCCAGTTTACCAAACGGGA
GGCTATCGGTCAAGGGATCAACGAAGCAGCTACGGATAAGTTACTATATA
TCGAATTTGTATGTAAATTTGTAAATAGTTTTAAGTAATAATAGTAGCGA
TTTTATGTACGAAATACGTTTACAATTATTTAACGAAGATTCCTCCCTCA
AATAAAAGAACGAAAGTGTTTGCAAAAAAAAAAAAAAA

RE03817.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:39:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG14329.a 1172 CG14329.a 1..1172 1..1172 5860 100 Plus
CG14329-RA 1171 CG14329-RA 72..897 1..826 4130 100 Plus
CG14329-RA 1171 CG14329-RA 897..1171 898..1172 1375 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13433696..13434867 1..1172 5860 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:27:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17609362..17610533 1..1172 5860 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:06:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17350193..17351364 1..1172 5860 100 Plus
Blast to na_te.dros performed on 2019-03-16 18:41:50 has no hits.

RE03817.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:42:38 Download gff for RE03817.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13433696..13434047 1..352 100 == Plus
chr3R 13434104..13434867 409..1173 96   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:47:58 Download gff for RE03817.complete
Subject Subject Range Query Range Percent Splice Strand
CG14329-RA 1..765 62..826 100 == Plus
CG14329-RA 766..906 899..1039 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:03:08 Download gff for RE03817.complete
Subject Subject Range Query Range Percent Splice Strand
CG14329-RA 1..765 62..826 100 == Plus
CG14329-RA 766..906 899..1039 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:16:11 Download gff for RE03817.complete
Subject Subject Range Query Range Percent Splice Strand
CG14329-RA 1..765 62..826 100 == Plus
CG14329-RA 766..906 899..1039 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:27:48 Download gff for RE03817.complete
Subject Subject Range Query Range Percent Splice Strand
CG14329-RA 1..765 62..826 100 == Plus
CG14329-RA 766..906 899..1039 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:47:10 Download gff for RE03817.complete
Subject Subject Range Query Range Percent Splice Strand
CG14329-RA 766..906 899..1039 100   Plus
CG14329-RA 1..765 62..826 100 == Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:30:10 Download gff for RE03817.complete
Subject Subject Range Query Range Percent Splice Strand
CG14329-RA 827..1100 899..1172 100   Plus
CG14329-RA 1..826 1..826 100 == Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:03:08 Download gff for RE03817.complete
Subject Subject Range Query Range Percent Splice Strand
CG14329-RA 827..1100 899..1172 100   Plus
CG14329-RA 1..826 1..826 100 == Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:16:11 Download gff for RE03817.complete
Subject Subject Range Query Range Percent Splice Strand
CG14329-RA 4..829 1..826 100 == Plus
CG14329-RA 830..1103 899..1172 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:27:48 Download gff for RE03817.complete
Subject Subject Range Query Range Percent Splice Strand
CG14329-RA 1..826 1..826 100 == Plus
CG14329-RA 827..1100 899..1172 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:47:10 Download gff for RE03817.complete
Subject Subject Range Query Range Percent Splice Strand
CG14329-RA 4..829 1..826 100 == Plus
CG14329-RA 830..1103 899..1172 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:42:38 Download gff for RE03817.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17609362..17610533 1..1173 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:42:38 Download gff for RE03817.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17609362..17610533 1..1173 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:42:38 Download gff for RE03817.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17609362..17610533 1..1173 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:16:11 Download gff for RE03817.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13435084..13436255 1..1173 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:03:35 Download gff for RE03817.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17350193..17351364 1..1173 99   Plus

RE03817.pep Sequence

Translation from 61 to 879

> RE03817.pep
MKLFLLLLLGALGYSLAYPRTYSYEYPRRRAYSTSYSGNSYSSLAGRKAR
EESTTSKSDKENAKFAGASNQELDETGDERTLLLKKKLKRLARPYLGGYG
GYGGYGGYGGYGGYGGGPCSPFGRDARGGQNQKDPAEQGRFLFDVNVVKV
YPGGCRGYGGGGLGGGLLSDPLPPVQPIPVPVRPYAPFATWLSLFAPGIL
NSAVVPGVPVRDPLRDPVRPAGDAQSDPEVDPNYAAPPPVRRPVPNRVYY
DSAGAVSSLTLIYCEFYIFIYC*

RE03817.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:23:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17813-PA 305 GF17813-PA 1..259 1..255 542 75.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:23:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22351-PA 304 GG22351-PA 1..258 1..255 722 94.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:23:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18095-PA 307 GH18095-PA 15..261 13..255 449 53.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG14329-PA 301 CG14329-PA 1..255 1..255 1372 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:23:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24593-PA 307 GI24593-PA 1..261 1..255 360 52.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:23:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21515-PA 315 GL21515-PA 16..268 15..255 474 65.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:23:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26308-PA 266 GA26308-PA 16..244 15..232 384 63.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:23:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15247-PA 301 GM15247-PA 1..255 1..255 1241 97.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:23:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19172-PA 299 GD19172-PA 1..253 1..255 1242 98 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:23:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22658-PA 312 GJ22658-PA 13..266 13..255 359 53.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:23:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12080-PA 308 GK12080-PA 37..260 35..255 447 63.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:23:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25484-PA 298 GE25484-PA 1..252 1..255 1228 96.1 Plus

RE03817.hyp Sequence

Translation from 61 to 879

> RE03817.hyp
MKLFLLLLLGALGYSLAYPRTYSYEYPRRRAYSTSYSGNSYSSLAGRKAR
EESTTSKSDKENAKFAGASNQELDETGDERTLLLKKKLKRLARPYLGGYG
GYGGYGGYGGYGGYGGGPCSPFGRDARGGQNQKDPAEQGRFLFDVNVVKV
YPGGCRGYGGGGLGGGLLSDPLPPVQPIPVPVRPYAPFATWLSLFAPGIL
NSAVVPGVPVRDPLRDPVRPAGDAQSDPEVDPNYAAPPPVRRPVPNRVYY
DSAGAVSSLTLIYCEFYIFIYC*

RE03817.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:24:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG14329-PA 301 CG14329-PA 1..255 1..255 1372 100 Plus