Clone RE04081 Report

Search the DGRC for RE04081

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:40
Well:81
Vector:pFlc-1
Associated Gene/Transcriptics-RA
Protein status:RE04081.pep: gold
Sequenced Size:1076

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
ics 2008-04-29 Release 5.5 accounting
ics 2008-04-29 Picked prior to 5.5
ics 2008-08-15 Release 5.9 accounting
ics 2008-12-18 5.12 accounting

Clone Sequence Records

RE04081.complete Sequence

1076 bp assembled on 2007-11-15

GenBank Submission: BT031285

> RE04081.complete
AGGGCGTATTAGGAATCAACGAAAATGAGTCAGTCTTGTATACCAGTGAG
CGCAAAGATGTCGAAGGCAAAGAAGGTTTTGGATGAAGCCCGAGAAACTC
ACAATCCCGAGTTGGATTTGGCCGACAAGGGGCTGTCGTCCTTCGAGGAG
TTGCCCGGACTGTTCAACATGTCCAACATCACGCGCTTGACCCTGTCCCA
CAACAAGATCAGCGTAATCAGTCCGGGAATCGCGAACCTACTGAATCTGG
AGATCCTGAACCTCTCGAACAACCAGCTGACCGAACTGCCCGTTTCGCTG
TCGTCCATGCCAAAGCTACGCATCCTCAATGTGTCCATCAATCGGCTGAT
AAATCTTCCTCGCGGCTTTGGAGCCTTTCCGGTGCTGGAAGTGCTCGACC
TGTCCTACAACAATCTCAACGAACAGGTCCTGCCTGGTAATTTCTTTGGT
ATGGAGACACTGCGTGCTCTGTATCTGGGCGACAATGACTTCGAGTATAT
ACCGAAGGAGGTGGGTCAGCTGAAGAATCTGCAGATACTCGGATTGCGTG
ACAACGATCTTCTGGAATTGCCCCGCGAAGTTGGGGATTTGGTGCGACTG
CGGGAGCTACATATTCAAAACAATAGGCTGCAGGTGCTGCCACCAGAGAT
CGCCCAGTTGGACCTACTGAGCAACAAGTCGGTCATGAAGATGGAGGAGA
ATCCCTGGGTCAATCCCATCGCCGAGCAATATCTGCTGGGCATTAGTCAC
GTCATCGACTACCTCAAAACGGAGACCTATAAGATCATCTACAACCGCCA
CTTGCAAGCAGGACGCAGTGGACCGCCGCCACCCAAAGCTGACAAAAGCA
AGAAGGCCTCTCGAATTCGCGCATAGTGATTCTCCACCAGAAGATCCCAA
GATCCCATGGAATTACAAATGTGTTCGTCTCGTTCGTTGTTAACCAAACC
CGTTTTCGTATACTAATTTATAAGTACTTTTAAACTAATGCGTATTTCTG
CAATGTGCCTTGACCCTTAGTTTCACTAATGAAAATAAAACAAAATAATA
GATGCATATATGTTAAAAAAAAAAAA

RE04081.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:36:00
Subject Length Description Subject Range Query Range Score Percent Strand
ics-RA 1171 ics-RA 32..1094 1..1063 5315 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:57:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13638548..13639169 785..164 3065 99.5 Minus
chr2L 23010047 chr2L 13638207..13638484 1063..786 1360 99.3 Minus
chr2L 23010047 chr2L 13639798..13639960 163..1 815 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:27:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:57:40
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13639860..13640481 785..164 3110 100 Minus
2L 23513712 2L 13639519..13639796 1063..786 1390 100 Minus
2L 23513712 2L 13641110..13641272 163..1 815 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:32:47
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13639860..13640481 785..164 3110 100 Minus
2L 23513712 2L 13639519..13639796 1063..786 1390 100 Minus
2L 23513712 2L 13641110..13641272 163..1 815 100 Minus
Blast to na_te.dros performed on 2019-03-15 18:57:41 has no hits.

RE04081.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:58:33 Download gff for RE04081.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13639798..13639960 1..163 100   Minus
chr2L 13638205..13638484 786..1064 98 <- Minus
chr2L 13638548..13639169 164..785 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:48:08 Download gff for RE04081.complete
Subject Subject Range Query Range Percent Splice Strand
ics-RA 1..852 25..876 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:06:02 Download gff for RE04081.complete
Subject Subject Range Query Range Percent Splice Strand
ics-RA 1..852 25..876 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:37:57 Download gff for RE04081.complete
Subject Subject Range Query Range Percent Splice Strand
ics-RA 1..852 25..876 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:52:19 Download gff for RE04081.complete
Subject Subject Range Query Range Percent Splice Strand
ics-RA 1..852 25..876 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:06:26 Download gff for RE04081.complete
Subject Subject Range Query Range Percent Splice Strand
ics-RA 1..852 25..876 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:00:48 Download gff for RE04081.complete
Subject Subject Range Query Range Percent Splice Strand
ics-RA 1..1054 2..1055 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:06:02 Download gff for RE04081.complete
Subject Subject Range Query Range Percent Splice Strand
ics-RA 1..1063 1..1063 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:37:57 Download gff for RE04081.complete
Subject Subject Range Query Range Percent Splice Strand
ics-RB 1..1063 1..1063 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:52:19 Download gff for RE04081.complete
Subject Subject Range Query Range Percent Splice Strand
ics-RA 1..1054 2..1055 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:06:26 Download gff for RE04081.complete
Subject Subject Range Query Range Percent Splice Strand
ics-RB 1..1063 1..1063 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:58:33 Download gff for RE04081.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13639517..13639796 786..1064 99 <- Minus
2L 13639860..13640481 164..785 100 <- Minus
2L 13641110..13641272 1..163 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:58:33 Download gff for RE04081.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13639517..13639796 786..1064 99 <- Minus
2L 13639860..13640481 164..785 100 <- Minus
2L 13641110..13641272 1..163 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:58:33 Download gff for RE04081.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13639517..13639796 786..1064 99 <- Minus
2L 13639860..13640481 164..785 100 <- Minus
2L 13641110..13641272 1..163 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:37:57 Download gff for RE04081.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13639517..13639796 786..1064 99 <- Minus
arm_2L 13639860..13640481 164..785 100 <- Minus
arm_2L 13641110..13641272 1..163 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:58:16 Download gff for RE04081.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13639517..13639796 786..1064 99 <- Minus
2L 13639860..13640481 164..785 100 <- Minus
2L 13641110..13641272 1..163 100   Minus

RE04081.hyp Sequence

Translation from 24 to 875

> RE04081.hyp
MSQSCIPVSAKMSKAKKVLDEARETHNPELDLADKGLSSFEELPGLFNMS
NITRLTLSHNKISVISPGIANLLNLEILNLSNNQLTELPVSLSSMPKLRI
LNVSINRLINLPRGFGAFPVLEVLDLSYNNLNEQVLPGNFFGMETLRALY
LGDNDFEYIPKEVGQLKNLQILGLRDNDLLELPREVGDLVRLRELHIQNN
RLQVLPPEIAQLDLLSNKSVMKMEENPWVNPIAEQYLLGISHVIDYLKTE
TYKIIYNRHLQAGRSGPPPPKADKSKKASRIRA*

RE04081.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:39:39
Subject Length Description Subject Range Query Range Score Percent Strand
ics-PC 283 CG9031-PC 1..283 1..283 1434 100 Plus
ics-PB 283 CG9031-PB 1..283 1..283 1434 100 Plus
ics-PA 283 CG9031-PA 1..283 1..283 1434 100 Plus
f-cup-PD 474 CG9611-PD 40..253 30..218 257 33.3 Plus
f-cup-PI 522 CG9611-PI 88..301 30..218 257 33.3 Plus
f-cup-PD 474 CG9611-PD 104..299 28..227 225 34.7 Plus
f-cup-PD 474 CG9611-PD 129..329 30..225 183 28.1 Plus

RE04081.pep Sequence

Translation from 24 to 875

> RE04081.pep
MSQSCIPVSAKMSKAKKVLDEARETHNPELDLADKGLSSFEELPGLFNMS
NITRLTLSHNKISVISPGIANLLNLEILNLSNNQLTELPVSLSSMPKLRI
LNVSINRLINLPRGFGAFPVLEVLDLSYNNLNEQVLPGNFFGMETLRALY
LGDNDFEYIPKEVGQLKNLQILGLRDNDLLELPREVGDLVRLRELHIQNN
RLQVLPPEIAQLDLLSNKSVMKMEENPWVNPIAEQYLLGISHVIDYLKTE
TYKIIYNRHLQAGRSGPPPPKADKSKKASRIRA*

RE04081.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:12:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21702-PA 272 GF21702-PA 1..272 12..283 1287 96.7 Plus
Dana\GF16442-PA 1847 GF16442-PA 56..231 46..226 230 33.7 Plus
Dana\GF16442-PA 1847 GF16442-PA 77..248 44..217 217 35.6 Plus
Dana\GF16883-PA 641 GF16883-PA 364..609 14..250 208 31.2 Plus
Dana\GF16442-PA 1847 GF16442-PA 180..383 30..214 207 32.9 Plus
Dana\GF18150-PA 782 GF18150-PA 236..465 39..218 204 30.7 Plus
Dana\GF18150-PA 782 GF18150-PA 316..499 28..212 201 35.8 Plus
Dana\GF16442-PA 1847 GF16442-PA 140..320 39..220 195 34.4 Plus
Dana\GF16883-PA 641 GF16883-PA 463..620 51..209 192 35 Plus
Dana\GF12306-PA 860 GF12306-PA 21..204 29..215 185 29.8 Plus
Dana\GF16883-PA 641 GF16883-PA 152..343 17..212 178 31.5 Plus
Dana\GF12306-PA 860 GF12306-PA 185..379 34..206 178 27.9 Plus
Dana\GF12306-PA 860 GF12306-PA 58..224 44..212 169 32.5 Plus
Dana\GF16442-PA 1847 GF16442-PA 38..177 74..215 165 33.8 Plus
Dana\GF12306-PA 860 GF12306-PA 76..245 40..210 156 30.2 Plus
Dana\GF16883-PA 641 GF16883-PA 246..383 44..206 149 27.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10189-PA 283 GG10189-PA 1..283 1..283 1433 98.2 Plus
Dere\GG11485-PA 1855 GG11485-PA 56..231 46..226 231 33.7 Plus
Dere\GG17029-PA 873 GG17029-PA 209..449 33..218 229 31.8 Plus
Dere\GG11485-PA 1855 GG11485-PA 77..248 44..217 217 35.6 Plus
Dere\GG16778-PA 644 GG16778-PA 413..612 45..250 209 32.9 Plus
Dere\GG11485-PA 1855 GG11485-PA 180..383 30..214 205 32.9 Plus
Dere\GG20492-PA 849 GG20492-PA 4..203 12..215 198 29.4 Plus
Dere\GG11485-PA 1855 GG11485-PA 171..346 46..226 195 33.7 Plus
Dere\GG17029-PA 873 GG17029-PA 300..495 28..227 191 35.6 Plus
Dere\GG16778-PA 644 GG16778-PA 466..623 51..209 189 35 Plus
Dere\GG20492-PA 849 GG20492-PA 234..406 60..237 174 28.7 Plus
Dere\GG16778-PA 644 GG16778-PA 155..334 17..226 172 29.9 Plus
Dere\GG11485-PA 1855 GG11485-PA 38..177 74..215 166 33.8 Plus
Dere\GG20492-PA 849 GG20492-PA 75..244 40..210 154 30.2 Plus
Dere\GG20492-PA 849 GG20492-PA 110..272 51..215 153 29.1 Plus
Dere\GG16778-PA 644 GG16778-PA 249..386 44..206 148 27.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13878-PA 272 GH13878-PA 1..272 12..283 1207 94.5 Plus
Dgri\GH10082-PA 1153 GH10082-PA 63..259 29..253 232 33.9 Plus
Dgri\GH14049-PA 744 GH14049-PA 200..388 39..206 229 34 Plus
Dgri\GH18723-PA 1864 GH18723-PA 56..231 46..226 229 33.7 Plus
Dgri\GH17496-PA 622 GH17496-PA 338..590 4..250 226 31.6 Plus
Dgri\GH18723-PA 1864 GH18723-PA 77..248 44..217 214 35.1 Plus
Dgri\GH18723-PA 1864 GH18723-PA 180..383 30..214 205 32.4 Plus
Dgri\GH18723-PA 1864 GH18723-PA 174..346 49..226 203 35.4 Plus
Dgri\GH17496-PA 622 GH17496-PA 143..299 52..210 196 34 Plus
Dgri\GH17496-PA 622 GH17496-PA 444..601 51..209 191 35.6 Plus
Dgri\GH14049-PA 744 GH14049-PA 572..717 30..177 178 37.6 Plus
Dgri\GH17496-PA 622 GH17496-PA 133..324 17..212 172 31 Plus
Dgri\GH18723-PA 1864 GH18723-PA 38..177 74..215 166 33.8 Plus
Dgri\GH14049-PA 744 GH14049-PA 568..739 74..248 162 28.2 Plus
Dgri\GH14049-PA 744 GH14049-PA 280..546 28..260 159 27 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:42
Subject Length Description Subject Range Query Range Score Percent Strand
ics-PC 283 CG9031-PC 1..283 1..283 1434 100 Plus
ics-PB 283 CG9031-PB 1..283 1..283 1434 100 Plus
ics-PA 283 CG9031-PA 1..283 1..283 1434 100 Plus
f-cup-PD 474 CG9611-PD 40..253 30..218 257 33.3 Plus
f-cup-PI 522 CG9611-PI 88..301 30..218 257 33.3 Plus
f-cup-PC 522 CG9611-PC 88..301 30..218 257 33.3 Plus
f-cup-PH 571 CG9611-PH 118..331 30..218 257 33.3 Plus
f-cup-PE 620 CG9611-PE 88..301 30..218 257 33.3 Plus
f-cup-PB 650 CG9611-PB 118..331 30..218 257 33.3 Plus
f-cup-PA 693 CG9611-PA 161..374 30..218 257 33.3 Plus
f-cup-PG 759 CG9611-PG 118..331 30..218 257 33.3 Plus
f-cup-PF 802 CG9611-PF 161..374 30..218 257 33.3 Plus
scrib-PC 1247 CG43398-PC 51..237 42..227 253 33.9 Plus
scrib-PI 1711 CG43398-PI 51..237 42..227 253 33.9 Plus
scrib-PP 1729 CG43398-PP 51..237 42..227 253 33.9 Plus
scrib-PB 1756 CG43398-PB 51..237 42..227 253 33.9 Plus
scrib-PA 1756 CG43398-PA 51..237 42..227 253 33.9 Plus
scrib-PU 1766 CG43398-PU 51..237 42..227 253 33.9 Plus
scrib-PD 1851 CG43398-PD 51..237 42..227 253 33.9 Plus
scrib-PH 1939 CG43398-PH 51..237 42..227 253 33.9 Plus
scrib-PR 1951 CG43398-PR 51..237 42..227 253 33.9 Plus
scrib-PK 2331 CG43398-PK 51..237 42..227 253 33.9 Plus
scrib-PJ 2426 CG43398-PJ 51..237 42..227 253 33.9 Plus
scrib-PT 2444 CG43398-PT 51..237 42..227 253 33.9 Plus
scrib-PM 2490 CG43398-PM 51..237 42..227 253 33.9 Plus
scrib-PO 2515 CG43398-PO 51..237 42..227 253 33.9 Plus
scrib-PN 2554 CG43398-PN 51..237 42..227 253 33.9 Plus
scrib-PQ 2577 CG43398-PQ 51..237 42..227 253 33.9 Plus
scrib-PL 2585 CG43398-PL 51..237 42..227 253 33.9 Plus
Sur-8-PF 641 CG5407-PF 357..609 4..250 244 30.4 Plus
Sur-8-PB 641 CG5407-PB 357..609 4..250 244 30.4 Plus
Sur-8-PA 641 CG5407-PA 357..609 4..250 244 30.4 Plus
Sur-8-PE 694 CG5407-PE 357..609 4..250 244 30.4 Plus
scrib-PC 1247 CG43398-PC 77..248 44..217 242 35.6 Plus
scrib-PI 1711 CG43398-PI 77..248 44..217 242 35.6 Plus
scrib-PP 1729 CG43398-PP 77..248 44..217 242 35.6 Plus
scrib-PB 1756 CG43398-PB 77..248 44..217 242 35.6 Plus
scrib-PA 1756 CG43398-PA 77..248 44..217 242 35.6 Plus
scrib-PU 1766 CG43398-PU 77..248 44..217 242 35.6 Plus
scrib-PD 1851 CG43398-PD 77..248 44..217 242 35.6 Plus
scrib-PH 1939 CG43398-PH 77..248 44..217 242 35.6 Plus
scrib-PR 1951 CG43398-PR 77..248 44..217 242 35.6 Plus
scrib-PK 2331 CG43398-PK 77..248 44..217 242 35.6 Plus
scrib-PJ 2426 CG43398-PJ 77..248 44..217 242 35.6 Plus
scrib-PT 2444 CG43398-PT 77..248 44..217 242 35.6 Plus
scrib-PM 2490 CG43398-PM 77..248 44..217 242 35.6 Plus
scrib-PO 2515 CG43398-PO 77..248 44..217 242 35.6 Plus
scrib-PN 2554 CG43398-PN 77..248 44..217 242 35.6 Plus
scrib-PQ 2577 CG43398-PQ 77..248 44..217 242 35.6 Plus
scrib-PL 2585 CG43398-PL 77..248 44..217 242 35.6 Plus
Lrch-PA 809 CG6860-PA 67..296 16..253 241 30.1 Plus
Lrch-PC 1079 CG6860-PC 67..296 16..253 241 30.1 Plus
Lrch-PB 1135 CG6860-PB 67..296 16..253 241 30.1 Plus
scrib-PC 1247 CG43398-PC 176..383 29..214 235 32.2 Plus
scrib-PI 1711 CG43398-PI 176..383 29..214 235 32.2 Plus
scrib-PP 1729 CG43398-PP 176..383 29..214 235 32.2 Plus
scrib-PB 1756 CG43398-PB 176..383 29..214 235 32.2 Plus
scrib-PA 1756 CG43398-PA 176..383 29..214 235 32.2 Plus
scrib-PU 1766 CG43398-PU 176..383 29..214 235 32.2 Plus
scrib-PD 1851 CG43398-PD 176..383 29..214 235 32.2 Plus
scrib-PH 1939 CG43398-PH 176..383 29..214 235 32.2 Plus
scrib-PR 1951 CG43398-PR 176..383 29..214 235 32.2 Plus
scrib-PK 2331 CG43398-PK 176..383 29..214 235 32.2 Plus
scrib-PJ 2426 CG43398-PJ 176..383 29..214 235 32.2 Plus
scrib-PT 2444 CG43398-PT 176..383 29..214 235 32.2 Plus
scrib-PM 2490 CG43398-PM 176..383 29..214 235 32.2 Plus
scrib-PO 2515 CG43398-PO 176..383 29..214 235 32.2 Plus
scrib-PN 2554 CG43398-PN 176..383 29..214 235 32.2 Plus
scrib-PQ 2577 CG43398-PQ 176..383 29..214 235 32.2 Plus
scrib-PL 2585 CG43398-PL 176..383 29..214 235 32.2 Plus
scrib-PC 1247 CG43398-PC 152..365 25..245 230 31.7 Plus
scrib-PI 1711 CG43398-PI 152..365 25..245 230 31.7 Plus
scrib-PP 1729 CG43398-PP 152..365 25..245 230 31.7 Plus
scrib-PB 1756 CG43398-PB 152..365 25..245 230 31.7 Plus
scrib-PA 1756 CG43398-PA 152..365 25..245 230 31.7 Plus
scrib-PU 1766 CG43398-PU 152..365 25..245 230 31.7 Plus
scrib-PD 1851 CG43398-PD 152..365 25..245 230 31.7 Plus
scrib-PH 1939 CG43398-PH 152..365 25..245 230 31.7 Plus
scrib-PR 1951 CG43398-PR 152..365 25..245 230 31.7 Plus
scrib-PK 2331 CG43398-PK 152..365 25..245 230 31.7 Plus
scrib-PJ 2426 CG43398-PJ 152..365 25..245 230 31.7 Plus
scrib-PT 2444 CG43398-PT 152..365 25..245 230 31.7 Plus
scrib-PM 2490 CG43398-PM 152..365 25..245 230 31.7 Plus
scrib-PO 2515 CG43398-PO 152..365 25..245 230 31.7 Plus
scrib-PN 2554 CG43398-PN 152..365 25..245 230 31.7 Plus
scrib-PQ 2577 CG43398-PQ 152..365 25..245 230 31.7 Plus
scrib-PL 2585 CG43398-PL 152..365 25..245 230 31.7 Plus
f-cup-PD 474 CG9611-PD 104..299 28..227 225 34.7 Plus
f-cup-PI 522 CG9611-PI 152..347 28..227 225 34.7 Plus
f-cup-PC 522 CG9611-PC 152..347 28..227 225 34.7 Plus
f-cup-PH 571 CG9611-PH 182..377 28..227 225 34.7 Plus
f-cup-PE 620 CG9611-PE 152..347 28..227 225 34.7 Plus
f-cup-PB 650 CG9611-PB 182..377 28..227 225 34.7 Plus
f-cup-PA 693 CG9611-PA 225..420 28..227 225 34.7 Plus
f-cup-PG 759 CG9611-PG 182..377 28..227 225 34.7 Plus
f-cup-PF 802 CG9611-PF 225..420 28..227 225 34.7 Plus
Sur-8-PF 641 CG5407-PF 463..620 51..209 224 35.6 Plus
Sur-8-PB 641 CG5407-PB 463..620 51..209 224 35.6 Plus
Sur-8-PA 641 CG5407-PA 463..620 51..209 224 35.6 Plus
Sur-8-PE 694 CG5407-PE 463..620 51..209 224 35.6 Plus
Lap1-PB 849 CG10255-PB 4..203 12..215 218 29.4 Plus
Lap1-PA 849 CG10255-PA 4..203 12..215 218 29.4 Plus
CG11099-PB 378 CG11099-PB 12..184 39..211 209 31.4 Plus
CG11099-PA 378 CG11099-PA 12..184 39..211 209 31.4 Plus
fliI-PA 1256 CG1484-PA 217..377 48..208 203 31.7 Plus
fliI-PA 1256 CG1484-PA 57..306 8..227 201 30.4 Plus
Sur-8-PF 641 CG5407-PF 152..346 17..215 198 30.5 Plus
Sur-8-PB 641 CG5407-PB 152..346 17..215 198 30.5 Plus
Sur-8-PA 641 CG5407-PA 152..346 17..215 198 30.5 Plus
Sur-8-PE 694 CG5407-PE 152..346 17..215 198 30.5 Plus
Lap1-PB 849 CG10255-PB 234..406 60..237 196 28.7 Plus
Lap1-PA 849 CG10255-PA 234..406 60..237 196 28.7 Plus
fliI-PA 1256 CG1484-PA 223..391 29..199 196 34.1 Plus
CG10307-PB 341 CG10307-PB 37..200 42..206 193 30.1 Plus
CG10307-PA 341 CG10307-PA 37..200 42..206 193 30.1 Plus
Lap1-PB 849 CG10255-PB 73..244 38..210 186 29.9 Plus
Lap1-PA 849 CG10255-PA 73..244 38..210 186 29.9 Plus
scrib-PC 1247 CG43398-PC 39..177 75..215 185 34 Plus
scrib-PI 1711 CG43398-PI 39..177 75..215 185 34 Plus
scrib-PP 1729 CG43398-PP 39..177 75..215 185 34 Plus
scrib-PB 1756 CG43398-PB 39..177 75..215 185 34 Plus
scrib-PA 1756 CG43398-PA 39..177 75..215 185 34 Plus
scrib-PU 1766 CG43398-PU 39..177 75..215 185 34 Plus
scrib-PD 1851 CG43398-PD 39..177 75..215 185 34 Plus
scrib-PH 1939 CG43398-PH 39..177 75..215 185 34 Plus
scrib-PR 1951 CG43398-PR 39..177 75..215 185 34 Plus
scrib-PK 2331 CG43398-PK 39..177 75..215 185 34 Plus
scrib-PJ 2426 CG43398-PJ 39..177 75..215 185 34 Plus
scrib-PT 2444 CG43398-PT 39..177 75..215 185 34 Plus
scrib-PM 2490 CG43398-PM 39..177 75..215 185 34 Plus
scrib-PO 2515 CG43398-PO 39..177 75..215 185 34 Plus
scrib-PN 2554 CG43398-PN 39..177 75..215 185 34 Plus
scrib-PQ 2577 CG43398-PQ 39..177 75..215 185 34 Plus
scrib-PL 2585 CG43398-PL 39..177 75..215 185 34 Plus
f-cup-PD 474 CG9611-PD 129..329 30..225 183 28.1 Plus
f-cup-PI 522 CG9611-PI 177..377 30..225 183 28.1 Plus
f-cup-PC 522 CG9611-PC 177..377 30..225 183 28.1 Plus
f-cup-PH 571 CG9611-PH 207..407 30..225 183 28.1 Plus
f-cup-PE 620 CG9611-PE 177..377 30..225 183 28.1 Plus
f-cup-PB 650 CG9611-PB 207..407 30..225 183 28.1 Plus
f-cup-PA 693 CG9611-PA 250..450 30..225 183 28.1 Plus
f-cup-PG 759 CG9611-PG 207..407 30..225 183 28.1 Plus
f-cup-PF 802 CG9611-PF 250..450 30..225 183 28.1 Plus
CG4168-PB 1330 CG4168-PB 715..952 30..257 181 29.2 Plus
CG4168-PC 1330 CG4168-PC 715..952 30..257 181 29.2 Plus
CG32687-PB 377 CG32687-PB 43..228 46..217 179 28.6 Plus
CG32687-PA 377 CG32687-PA 43..228 46..217 179 28.6 Plus
fliI-PA 1256 CG1484-PA 15..181 60..227 176 29.4 Plus
conv-PA 1092 CG8561-PA 503..663 38..203 176 35.4 Plus
conv-PB 1092 CG8561-PB 503..663 38..203 176 35.4 Plus
Sur-8-PF 641 CG5407-PF 234..405 30..230 175 26.4 Plus
Sur-8-PB 641 CG5407-PB 234..405 30..230 175 26.4 Plus
Sur-8-PA 641 CG5407-PA 234..405 30..230 175 26.4 Plus
Sur-8-PE 694 CG5407-PE 234..405 30..230 175 26.4 Plus
Lap1-PB 849 CG10255-PB 110..272 51..215 174 29.1 Plus
Lap1-PA 849 CG10255-PA 110..272 51..215 174 29.1 Plus
CG3494-PB 240 CG3494-PB 29..236 44..249 172 25.8 Plus
CG3494-PA 240 CG3494-PA 29..236 44..249 172 25.8 Plus
CG10307-PB 341 CG10307-PB 28..183 55..212 171 30.4 Plus
CG10307-PA 341 CG10307-PA 28..183 55..212 171 30.4 Plus
CG32687-PB 377 CG32687-PB 134..261 75..204 170 34.6 Plus
CG32687-PA 377 CG32687-PA 134..261 75..204 170 34.6 Plus
CG10307-PB 341 CG10307-PB 28..163 78..215 168 31.9 Plus
CG10307-PA 341 CG10307-PA 28..163 78..215 168 31.9 Plus
f-cup-PE 620 CG9611-PE 439..615 69..248 166 29.7 Plus
f-cup-PB 650 CG9611-PB 469..645 69..248 166 29.7 Plus
f-cup-PA 693 CG9611-PA 512..688 69..248 166 29.7 Plus
f-cup-PG 759 CG9611-PG 578..754 69..248 166 29.7 Plus
f-cup-PF 802 CG9611-PF 621..797 69..248 166 29.7 Plus
fliI-PA 1256 CG1484-PA 28..201 49..223 165 31.5 Plus
f-cup-PE 620 CG9611-PE 435..593 17..177 161 32.7 Plus
f-cup-PB 650 CG9611-PB 465..623 17..177 161 32.7 Plus
f-cup-PA 693 CG9611-PA 508..666 17..177 161 32.7 Plus
f-cup-PG 759 CG9611-PG 574..732 17..177 161 32.7 Plus
f-cup-PF 802 CG9611-PF 617..775 17..177 161 32.7 Plus
conv-PA 1092 CG8561-PA 387..621 48..272 161 28 Plus
conv-PB 1092 CG8561-PB 387..621 48..272 161 28 Plus
Lap1-PB 849 CG10255-PB 145..377 41..232 158 24.9 Plus
Lap1-PA 849 CG10255-PA 145..377 41..232 158 24.9 Plus
CG11099-PB 378 CG11099-PB 1..150 73..224 154 28.9 Plus
CG11099-PA 378 CG11099-PA 1..150 73..224 154 28.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:12:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10104-PA 282 GI10104-PA 4..282 5..283 1243 91.8 Plus
Dmoj\GI22874-PA 1865 GI22874-PA 56..231 46..226 232 33.7 Plus
Dmoj\GI22824-PA 471 GI22824-PA 244..418 46..227 227 36.8 Plus
Dmoj\GI24424-PA 694 GI24424-PA 229..412 28..212 222 36.9 Plus
Dmoj\GI22874-PA 1865 GI22874-PA 77..248 44..217 220 35.6 Plus
Dmoj\GI24424-PA 694 GI24424-PA 149..337 39..206 220 35.1 Plus
Dmoj\GI22874-PA 1865 GI22874-PA 180..383 30..214 209 32.9 Plus
Dmoj\GI18937-PA 335 GI18937-PA 36..200 41..206 206 30.5 Plus
Dmoj\GI22874-PA 1865 GI22874-PA 174..346 49..226 204 35.4 Plus
Dmoj\GI22824-PA 471 GI22824-PA 277..450 34..209 193 35.4 Plus
Dmoj\GI22824-PA 471 GI22824-PA 135..291 52..210 188 33.3 Plus
Dmoj\GI22874-PA 1865 GI22874-PA 38..177 74..215 165 33.8 Plus
Dmoj\GI24424-PA 694 GI24424-PA 510..667 18..177 162 34.8 Plus
Dmoj\GI24424-PA 694 GI24424-PA 519..689 75..248 151 28.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25689-PA 282 GL25689-PA 1..282 1..283 1306 93.6 Plus
Dper\GL18758-PA 1174 GL18758-PA 50..279 16..253 220 30.5 Plus
Dper\GL24452-PA 655 GL24452-PA 115..297 39..200 218 35 Plus
Dper\GL23097-PA 1247 GL23097-PA 226..429 30..214 208 32.9 Plus
Dper\GL23097-PA 1247 GL23097-PA 220..411 49..245 195 33 Plus
Dper\GL23097-PA 1247 GL23097-PA 159..323 57..226 194 34.1 Plus
Dper\GL23097-PA 1247 GL23097-PA 136..294 57..217 189 35.4 Plus
Dper\GL24452-PA 655 GL24452-PA 183..411 17..248 176 30.6 Plus
Dper\GL23097-PA 1247 GL23097-PA 56..277 46..226 175 26.9 Plus
Dper\GL10378-PA 188 GL10378-PA 4..185 12..197 175 29.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25391-PA 282 GA25391-PA 1..282 1..283 1306 93.6 Plus
Dpse\GA18897-PA 1889 GA18897-PA 56..231 46..226 228 33.1 Plus
Dpse\GA19911-PA 1178 GA19911-PA 50..279 16..253 220 30.5 Plus
Dpse\GA26616-PC 511 GA26616-PC 76..263 39..205 217 34.6 Plus
Dpse\GA18897-PA 1889 GA18897-PA 77..248 44..217 216 35.6 Plus
Dpse\GA27118-PA 629 GA27118-PA 345..597 4..250 215 31.2 Plus
Dpse\GA18897-PA 1889 GA18897-PA 180..383 30..214 207 32.9 Plus
Dpse\GA27118-PA 629 GA27118-PA 150..306 52..210 200 35.2 Plus
Dpse\GA27118-PA 629 GA27118-PA 451..608 51..209 197 36.2 Plus
Dpse\GA18897-PA 1889 GA18897-PA 174..346 49..226 193 34.3 Plus
Dpse\GA26616-PC 511 GA26616-PC 144..351 17..227 175 31.8 Plus
Dpse\GA27118-PA 629 GA27118-PA 140..331 17..212 175 31 Plus
Dpse\GA18897-PA 1889 GA18897-PA 39..177 75..215 164 34.8 Plus
Dpse\GA27118-PA 629 GA27118-PA 234..371 44..206 151 28.2 Plus
Dpse\GA27118-PA 629 GA27118-PA 288..518 30..212 148 25.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:12:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25411-PA 283 GM25411-PA 1..283 1..283 1456 99.6 Plus
Dsec\GM10328-PA 1851 GM10328-PA 56..231 46..226 231 33.7 Plus
Dsec\GM25913-PA 898 GM25913-PA 257..470 30..218 227 32.9 Plus
Dsec\GM10328-PA 1851 GM10328-PA 77..248 44..217 217 35.6 Plus
Dsec\GM15368-PA 683 GM15368-PA 360..612 4..250 209 30.8 Plus
Dsec\GM10328-PA 1851 GM10328-PA 180..383 30..214 206 32.9 Plus
Dsec\GM25913-PA 898 GM25913-PA 321..516 28..227 197 35.6 Plus
Dsec\GM21584-PA 903 GM21584-PA 58..257 12..215 197 29.4 Plus
Dsec\GM10328-PA 1851 GM10328-PA 171..346 46..226 195 33.7 Plus
Dsec\GM25913-PA 898 GM25913-PA 230..396 33..224 191 32 Plus
Dsec\GM15368-PA 683 GM15368-PA 466..623 51..209 190 35 Plus
Dsec\GM21584-PA 903 GM21584-PA 288..460 60..237 175 28.7 Plus
Dsec\GM15368-PA 683 GM15368-PA 155..346 17..212 174 30.5 Plus
Dsec\GM10328-PA 1851 GM10328-PA 38..177 74..215 166 33.8 Plus
Dsec\GM21584-PA 903 GM21584-PA 129..298 40..210 155 30.2 Plus
Dsec\GM21584-PA 903 GM21584-PA 164..326 51..215 153 29.1 Plus
Dsec\GM15368-PA 683 GM15368-PA 233..386 29..206 149 26.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:12:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22052-PA 283 GD22052-PA 1..283 1..283 1456 99.6 Plus
Dsim\GD21289-PA 2647 GD21289-PA 56..231 46..226 232 33.7 Plus
Dsim\GD21289-PA 2647 GD21289-PA 77..248 44..217 217 35.6 Plus
Dsim\GD20236-PA 724 GD20236-PA 401..632 4..227 210 32.5 Plus
Dsim\GD21289-PA 2647 GD21289-PA 180..383 30..214 205 32.9 Plus
Dsim\GD11090-PA 776 GD11090-PA 4..207 12..226 195 28.8 Plus
Dsim\GD21289-PA 2647 GD21289-PA 171..346 46..226 194 33.7 Plus
Dsim\GD20236-PA 724 GD20236-PA 507..664 51..209 190 35 Plus
Dsim\GD24888-PA 1125 GD24888-PA 217..377 48..208 187 31.7 Plus
Dsim\GD24888-PA 1125 GD24888-PA 223..391 29..199 174 34.1 Plus
Dsim\GD21289-PA 2647 GD21289-PA 38..177 74..215 166 33.8 Plus
Dsim\GD20236-PA 724 GD20236-PA 228..390 51..215 166 31.5 Plus
Dsim\GD11090-PA 776 GD11090-PA 144..333 40..237 166 29.1 Plus
Dsim\GD24888-PA 1125 GD24888-PA 94..287 44..212 164 32 Plus
Dsim\GD24888-PA 1125 GD24888-PA 12..181 57..227 155 28.9 Plus
Dsim\GD20236-PA 724 GD20236-PA 290..427 44..206 150 27.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18367-PA 272 GJ18367-PA 1..272 12..283 1267 94.9 Plus
Dvir\GJ14282-PA 750 GJ14282-PA 115..287 30..206 247 38.4 Plus
Dvir\GJ16236-PA 1150 GJ16236-PA 50..279 16..253 238 31.8 Plus
Dvir\GJ22826-PA 614 GJ22826-PA 332..582 6..250 214 30.7 Plus
Dvir\GJ14282-PA 750 GJ14282-PA 179..362 28..212 213 36.4 Plus
Dvir\GJ22826-PA 614 GJ22826-PA 135..304 52..226 197 32.6 Plus
Dvir\GJ21310-PA 337 GJ21310-PA 37..200 42..206 194 31.9 Plus
Dvir\GJ22826-PA 614 GJ22826-PA 436..593 51..209 192 35.6 Plus
Dvir\GJ14282-PA 750 GJ14282-PA 578..723 30..177 182 37.5 Plus
Dvir\GJ14282-PA 750 GJ14282-PA 99..257 39..222 175 32.1 Plus
Dvir\GJ22826-PA 614 GJ22826-PA 125..316 17..212 171 31 Plus
Dvir\GJ21310-PA 337 GJ21310-PA 28..177 55..206 167 30.3 Plus
Dvir\GJ14282-PA 750 GJ14282-PA 569..745 69..248 161 28.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24552-PA 272 GK24552-PA 1..272 12..283 1253 94.5 Plus
Dwil\GK13318-PA 1874 GK13318-PA 56..231 46..226 230 33.7 Plus
Dwil\GK13066-PA 650 GK13066-PA 98..286 39..206 227 34.4 Plus
Dwil\GK13318-PA 1874 GK13318-PA 77..248 44..217 216 35.6 Plus
Dwil\GK11454-PA 641 GK11454-PA 357..609 4..250 212 30.8 Plus
Dwil\GK13318-PA 1874 GK13318-PA 215..383 44..214 208 35.1 Plus
Dwil\GK13066-PA 650 GK13066-PA 149..327 44..218 205 34.6 Plus
Dwil\GK13066-PA 650 GK13066-PA 190..373 40..227 199 35.8 Plus
Dwil\GK13318-PA 1874 GK13318-PA 174..346 49..226 195 34.3 Plus
Dwil\GK11454-PA 641 GK11454-PA 162..331 52..226 194 33.1 Plus
Dwil\GK21518-PA 831 GK21518-PA 22..203 30..215 193 30.6 Plus
Dwil\GK11454-PA 641 GK11454-PA 463..620 51..209 192 35.6 Plus
Dwil\GK21518-PA 831 GK21518-PA 184..401 34..229 172 27.7 Plus
Dwil\GK13318-PA 1874 GK13318-PA 39..177 75..215 166 34 Plus
Dwil\GK13066-PA 650 GK13066-PA 465..623 17..177 165 35.6 Plus
Dwil\GK21518-PA 831 GK21518-PA 75..245 40..211 156 30.6 Plus
Dwil\GK11454-PA 641 GK11454-PA 304..530 34..212 152 26.9 Plus
Dwil\GK11454-PA 641 GK11454-PA 227..383 26..206 152 27.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11514-PA 272 GE11514-PA 1..272 12..283 1375 98.9 Plus
Dyak\GE24422-PA 928 GE24422-PA 288..501 30..218 233 33.3 Plus
Dyak\GE23676-PA 1857 GE23676-PA 56..231 46..226 231 33.7 Plus
Dyak\GE23676-PA 1857 GE23676-PA 77..248 44..217 217 35.6 Plus
Dyak\GE24170-PA 645 GE24170-PA 361..613 4..250 209 30.8 Plus
Dyak\GE23676-PA 1857 GE23676-PA 180..383 30..214 206 32.9 Plus
Dyak\GE13624-PA 849 GE13624-PA 4..203 12..215 198 29.4 Plus
Dyak\GE23676-PA 1857 GE23676-PA 171..346 46..226 195 33.7 Plus
Dyak\GE24422-PA 928 GE24422-PA 352..547 28..227 192 35.6 Plus
Dyak\GE24170-PA 645 GE24170-PA 467..624 51..209 190 35 Plus
Dyak\GE24422-PA 928 GE24422-PA 272..430 39..222 185 30.4 Plus
Dyak\GE13624-PA 849 GE13624-PA 234..406 60..237 177 29.2 Plus
Dyak\GE24170-PA 645 GE24170-PA 156..347 17..212 171 30.5 Plus
Dyak\GE23676-PA 1857 GE23676-PA 38..177 74..215 166 33.8 Plus
Dyak\GE13624-PA 849 GE13624-PA 75..244 40..210 154 30.2 Plus
Dyak\GE13624-PA 849 GE13624-PA 110..280 51..226 154 29 Plus
Dyak\GE24170-PA 645 GE24170-PA 250..387 44..206 149 27.6 Plus