Clone RE04130 Report

Search the DGRC for RE04130

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:41
Well:30
Vector:pFlc-1
Associated Gene/TranscriptCG15739-RA
Protein status:RE04130.pep: gold
Preliminary Size:984
Sequenced Size:1428

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15739 2001-12-14 Blastp of sequenced clone
CG15739 2002-01-01 Sim4 clustering to Release 2
CG15739 2003-01-01 Sim4 clustering to Release 3
CG15739 2008-04-29 Release 5.5 accounting
CG15739 2008-08-15 Release 5.9 accounting
CG15739 2008-12-18 5.12 accounting

Clone Sequence Records

RE04130.complete Sequence

1428 bp (1428 high quality bases) assembled on 2001-12-14

GenBank Submission: AY070946

> RE04130.complete
AGTTGGCTGACGACCGTGATCGCGATAGCAACACTTTCACTCACCAGAAC
GGATTGCAATGGCCAAACCCCAGCACATTTTGCAGCTAAGCCAGGAGCAG
CGGAGCAGCGTTGTCGACTCTTTCGACCGGGTGGTCAGCGACATCGATGG
CGTCCTGTGGACCTTTGAGCAGAGCATTCCGCGTGCCGCCGACGGATATG
CCGCTCTCGAGCAGATGGGCAAGCATCTGACCTTCCTGACCAACAACAGC
GTTCGCACGTCCGAGCAGTGCGTCAAACTCTTCGCCAAGATCGGGATGCA
GGTGCACCCGGAGCAGATTTGGCATCCGGCCAAGTCCATCGTTAGCTATC
TGCAGAGCATCAAGTTCGAGGGACTCATCTACATCATCGCCAGCCAGTCG
TTCAAGACGGTGTTGCGCGAGGCGGGATTCCAGCTCCTGGACGGGCCCAA
CGAGTTCATCGAGGAGAGCTACGCCAGCCTGGCCGAGCACATCTTTGGCA
AGGAGCCCGTGCGCGCCGTCATCATCGACGTGGACTTCAATCTGACTTCC
CCGAAGATTCTGCGCGCCCACCTGTACCTGCGCCATCCGGAGTGTATGCT
CATTGAAGGCGCCACCGATCGCCTGCTACCGGTGGCCAAGGAAGTGAACA
TCGTAGGTCCGGGAGCCTTCGCCTCCATCCTCGTGGAGGCCAGTGGCAAG
CAGCCGATTACGTTGGGCAAGCCTGGCCGCGAGTTGGGTGATCTGCTTGT
CGAGCATTACCAAATCGTTCAGCCCAGTCGGGTGCTCATGATCGGAGATA
TGTTGGCCCAGGACGTTAGCTTTGGACGCCAGTGCGGATTCCAAACGCTG
CTCGTGCTCAGCGGCGGATGCAGCAAGGAGGAGCTCCTGGCCGAGACGGA
TCCGCAGCGCATACCGGACTACTATGCGGACAGCGTGGCCGATGTGGCCC
AGATGCTGGGCGAGGCGCCCAAGTCGCGTGTCTAGACGGCGTCCGGCGGA
GGAGATCGAAAAACGATATATCCATTGGCTATAGCTGTACCTGGGTACCT
GGGTAGCTGATATAGTGTCGTATTCCTAACCAGATCACATTCTGTCTGCG
AAATTTGAATCATAGTAAGCAAACAGAGTTGACGAACTTGGGAGTTCCAG
GAAAACAAAACCACTGCAACCATTTGGTCGTAAAAGATCCATAGATGTAC
AGTGCATATAAACAAATAAACAATATATATGTATATAGTCTAGCTGAAAC
AATGCACTATATTTTATTAGCTAAAATATATGTACACAATTACTAATGAC
ATTAGAGACAAGCGATCGAACTTTGGGATACCCCGCAATTCACAGTGTAA
AGAGATTTAAGGTTGTGAACAAATAAAAAGTTTAGTTTTATTTATAAATT
TCGCCAAAAAAATAAAAAAAAAAAAAAA

RE04130.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:39:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG15739-RA 1667 CG15739-RA 256..1667 1..1412 7060 100 Plus
CG15739.a 1577 CG15739.a 226..1577 61..1412 6760 100 Plus
CG15739.a 1577 CG15739.a 125..186 1..62 310 100 Plus
CG10352.a 1387 CG10352.a 1340..1387 1412..1365 240 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:02:11
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11765515..11766483 445..1413 4830 99.9 Plus
chrX 22417052 chrX 11765010..11765394 61..445 1910 99.7 Plus
chrX 22417052 chrX 11764572..11764633 1..62 310 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:27:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:02:09
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11874386..11875353 445..1412 4840 100 Plus
X 23542271 X 11873881..11874265 61..445 1925 100 Plus
X 23542271 X 11873443..11873504 1..62 310 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:06:40
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11882484..11883451 445..1412 4840 100 Plus
X 23527363 X 11881979..11882363 61..445 1925 100 Plus
X 23527363 X 11881541..11881602 1..62 310 100 Plus
Blast to na_te.dros performed 2019-03-15 14:02:09
Subject Length Description Subject Range Query Range Score Percent Strand
McClintock 6450 McClintock McCLINTOCK 6450bp 5657..5811 1167..1316 123 57.1 Plus
Dbuz\Osvaldo 9045 Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). 38..94 1237..1180 116 69 Minus
Dbuz\Osvaldo 9045 Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). 7887..7943 1237..1180 116 69 Minus

RE04130.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:03:18 Download gff for RE04130.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11764572..11764632 1..61 100 -> Plus
chrX 11765011..11765394 62..445 99 -> Plus
chrX 11765516..11766483 446..1413 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:48:12 Download gff for RE04130.complete
Subject Subject Range Query Range Percent Splice Strand
CG15739-RA 1..927 59..985 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:03:43 Download gff for RE04130.complete
Subject Subject Range Query Range Percent Splice Strand
CG15739-RA 1..927 59..985 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:15:32 Download gff for RE04130.complete
Subject Subject Range Query Range Percent Splice Strand
CG15739-RA 1..927 59..985 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:28:20 Download gff for RE04130.complete
Subject Subject Range Query Range Percent Splice Strand
CG15739-RA 1..927 59..985 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:47:27 Download gff for RE04130.complete
Subject Subject Range Query Range Percent Splice Strand
CG15739-RA 1..927 59..985 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:30:58 Download gff for RE04130.complete
Subject Subject Range Query Range Percent Splice Strand
CG15739-RA 1..1412 1..1412 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:03:43 Download gff for RE04130.complete
Subject Subject Range Query Range Percent Splice Strand
CG15739-RA 125..1528 1..1404 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:15:32 Download gff for RE04130.complete
Subject Subject Range Query Range Percent Splice Strand
CG15739-RA 125..1529 1..1405 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:28:20 Download gff for RE04130.complete
Subject Subject Range Query Range Percent Splice Strand
CG15739-RA 1..1412 1..1412 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:47:27 Download gff for RE04130.complete
Subject Subject Range Query Range Percent Splice Strand
CG15739-RA 125..1529 1..1405 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:03:18 Download gff for RE04130.complete
Subject Subject Range Query Range Percent Splice Strand
X 11873443..11873503 1..61 100 -> Plus
X 11873882..11874265 62..445 100 -> Plus
X 11874387..11875353 446..1413 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:03:18 Download gff for RE04130.complete
Subject Subject Range Query Range Percent Splice Strand
X 11873443..11873503 1..61 100 -> Plus
X 11873882..11874265 62..445 100 -> Plus
X 11874387..11875353 446..1413 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:03:18 Download gff for RE04130.complete
Subject Subject Range Query Range Percent Splice Strand
X 11873443..11873503 1..61 100 -> Plus
X 11873882..11874265 62..445 100 -> Plus
X 11874387..11875353 446..1413 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:15:32 Download gff for RE04130.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11767476..11767536 1..61 100 -> Plus
arm_X 11767915..11768298 62..445 100 -> Plus
arm_X 11768420..11769386 446..1413 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:04:15 Download gff for RE04130.complete
Subject Subject Range Query Range Percent Splice Strand
X 11881980..11882363 62..445 100 -> Plus
X 11882485..11883451 446..1413 99   Plus
X 11881541..11881601 1..61 100 -> Plus

RE04130.hyp Sequence

Translation from 58 to 984

> RE04130.hyp
MAKPQHILQLSQEQRSSVVDSFDRVVSDIDGVLWTFEQSIPRAADGYAAL
EQMGKHLTFLTNNSVRTSEQCVKLFAKIGMQVHPEQIWHPAKSIVSYLQS
IKFEGLIYIIASQSFKTVLREAGFQLLDGPNEFIEESYASLAEHIFGKEP
VRAVIIDVDFNLTSPKILRAHLYLRHPECMLIEGATDRLLPVAKEVNIVG
PGAFASILVEASGKQPITLGKPGRELGDLLVEHYQIVQPSRVLMIGDMLA
QDVSFGRQCGFQTLLVLSGGCSKEELLAETDPQRIPDYYADSVADVAQML
GEAPKSRV*

RE04130.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:03:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG15739-PB 308 CG15739-PB 1..308 1..308 1567 100 Plus
CG15739-PA 308 CG15739-PA 1..308 1..308 1567 100 Plus
CG10352-PB 315 CG10352-PB 1..299 1..297 641 44 Plus
CG2680-PB 305 CG2680-PB 1..305 1..305 491 37.7 Plus
CG5567-PA 330 CG5567-PA 23..318 6..296 378 30.9 Plus

RE04130.pep Sequence

Translation from 58 to 984

> RE04130.pep
MAKPQHILQLSQEQRSSVVDSFDRVVSDIDGVLWTFEQSIPRAADGYAAL
EQMGKHLTFLTNNSVRTSEQCVKLFAKIGMQVHPEQIWHPAKSIVSYLQS
IKFEGLIYIIASQSFKTVLREAGFQLLDGPNEFIEESYASLAEHIFGKEP
VRAVIIDVDFNLTSPKILRAHLYLRHPECMLIEGATDRLLPVAKEVNIVG
PGAFASILVEASGKQPITLGKPGRELGDLLVEHYQIVQPSRVLMIGDMLA
QDVSFGRQCGFQTLLVLSGGCSKEELLAETDPQRIPDYYADSVADVAQML
GEAPKSRV*

RE04130.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:28:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21574-PA 310 GF21574-PA 4..308 2..306 1134 67.2 Plus
Dana\GF21591-PA 273 GF21591-PA 4..273 31..299 623 45.8 Plus
Dana\GF22487-PA 305 GF22487-PA 1..300 1..300 523 38 Plus
Dana\GF25232-PA 316 GF25232-PA 8..303 6..296 393 29.9 Plus
Dana\GF10230-PA 309 GF10230-PA 15..300 6..296 305 28.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:28:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18450-PA 308 GG18450-PA 1..308 1..308 1462 88.3 Plus
Dere\GG18824-PA 305 GG18824-PA 22..296 31..306 595 44.1 Plus
Dere\GG18612-PA 305 GG18612-PA 1..300 1..300 513 38.4 Plus
Dere\GG15774-PA 315 GG15774-PA 8..303 6..296 398 31.5 Plus
Dere\GG14489-PA 320 GG14489-PA 15..315 6..300 323 28 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:28:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12276-PA 311 GH12276-PA 5..304 3..302 1028 60.7 Plus
Dgri\GH12470-PA 265 GH12470-PA 5..264 40..298 581 46 Plus
Dgri\GH11944-PA 305 GH11944-PA 3..301 4..300 526 39.6 Plus
Dgri\GH14463-PA 316 GH14463-PA 8..310 6..303 384 29.8 Plus
Dgri\GH23184-PA 319 GH23184-PA 14..314 6..300 312 28.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG15739-PB 308 CG15739-PB 1..308 1..308 1567 100 Plus
CG15739-PA 308 CG15739-PA 1..308 1..308 1567 100 Plus
CG10352-PB 315 CG10352-PB 1..299 1..297 641 44 Plus
CG2680-PB 305 CG2680-PB 1..305 1..305 491 37.7 Plus
CG5567-PA 330 CG5567-PA 23..318 6..296 378 30.9 Plus
CG32487-PA 320 CG32487-PA 16..315 7..300 313 28.4 Plus
CG32488-PB 307 CG32488-PB 9..306 7..300 294 24.7 Plus
CG32488-PA 307 CG32488-PA 9..306 7..300 294 24.7 Plus
CG11291-PA 308 CG11291-PA 8..306 6..300 273 25.7 Plus
CG5577-PB 315 CG5577-PB 12..315 10..300 222 27.2 Plus
CG5577-PA 315 CG5577-PA 12..315 10..300 222 27.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:28:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10972-PA 323 GI10972-PA 15..321 1..306 1119 67.4 Plus
Dmoj\GI11147-PA 305 GI11147-PA 31..300 29..296 587 44.1 Plus
Dmoj\GI11145-PA 1237 GI11145-PA 967..1234 32..298 572 43.1 Plus
Dmoj\GI14731-PA 303 GI14731-PA 3..299 4..300 516 40.1 Plus
Dmoj\GI13608-PA 316 GI13608-PA 8..303 6..296 393 31.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:28:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20155-PA 312 GL20155-PA 5..312 2..308 1256 74.7 Plus
Dper\GL20404-PA 302 GL20404-PA 1..298 1..296 646 42.7 Plus
Dper\GL19811-PA 305 GL19811-PA 1..300 1..300 543 39 Plus
Dper\GL18197-PA 321 GL18197-PA 28..312 18..296 357 30.6 Plus
Dper\GL22743-PA 314 GL22743-PA 10..305 6..296 331 28.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:28:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13927-PA 312 GA13927-PA 5..312 2..308 1257 75 Plus
Dpse\GA29193-PA 357 GA29193-PA 40..353 5..296 604 39.9 Plus
Dpse\GA15426-PA 305 GA15426-PA 1..300 1..300 540 39 Plus
Dpse\GA16941-PA 321 GA16941-PA 28..312 18..296 355 30.6 Plus
Dpse\GA18976-PA 314 GA18976-PA 10..305 6..296 331 28.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:28:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13116-PA 308 GM13116-PA 1..308 1..308 1527 92.2 Plus
Dsec\GM13036-PA 286 GM13036-PA 5..271 32..297 606 45.5 Plus
Dsec\GM13035-PA 300 GM13035-PA 19..285 32..297 605 45.5 Plus
Dsec\GM18860-PA 305 GM18860-PA 1..300 1..300 497 37.4 Plus
Dsec\GM24299-PA 315 GM24299-PA 8..303 6..296 391 31.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:28:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17054-PA 300 GD17054-PA 2..300 10..308 1479 91.6 Plus
Dsim\GD15960-PA 305 GD15960-PA 1..290 10..297 658 45.4 Plus
Dsim\GD16358-PA 305 GD16358-PA 1..300 1..300 504 38 Plus
Dsim\GD12368-PA 315 GD12368-PA 8..303 6..296 392 31.2 Plus
Dsim\GD13364-PA 320 GD13364-PA 15..315 6..300 322 27.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:28:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18530-PA 311 GJ18530-PA 6..311 4..308 1179 69.6 Plus
Dvir\GJ18523-PA 278 GJ18523-PA 8..276 31..297 593 44.6 Plus
Dvir\GJ18537-PA 304 GJ18537-PA 3..299 4..300 537 39.5 Plus
Dvir\GJ13944-PA 316 GJ13944-PA 8..303 6..296 408 31.5 Plus
Dvir\GJ11756-PA 321 GJ11756-PA 12..316 5..300 362 29.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:28:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25499-PA 314 GK25499-PA 8..314 3..308 1189 69.4 Plus
Dwil\GK25422-PA 335 GK25422-PA 29..330 3..296 622 43.9 Plus
Dwil\GK20059-PA 305 GK20059-PA 1..301 1..300 511 36.7 Plus
Dwil\GK21181-PA 318 GK21181-PA 10..312 6..303 400 31.5 Plus
Dwil\GK17623-PA 311 GK17623-PA 8..310 6..300 333 27.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:28:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15672-PA 308 GE15672-PA 1..308 1..308 1447 87 Plus
Dyak\GE17588-PA 305 GE17588-PA 1..290 10..297 648 44.7 Plus
Dyak\GE16927-PA 305 GE16927-PA 1..305 1..305 503 37.4 Plus
Dyak\GE22109-PA 315 GE22109-PA 8..303 6..296 395 31.2 Plus
Dyak\GE21678-PA 320 GE21678-PA 15..315 6..300 331 28.5 Plus