Clone RE04580 Report

Search the DGRC for RE04580

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:45
Well:80
Vector:pFlc-1
Associated Gene/TranscriptCG7406-RA
Protein status:RE04580.pep: gold
Preliminary Size:575
Sequenced Size:823

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7406 2002-01-01 Sim4 clustering to Release 2
CG7406 2002-02-22 Blastp of sequenced clone
CG7406 2003-01-01 Sim4 clustering to Release 3
CG7406 2008-04-29 Release 5.5 accounting
CG7406 2008-08-15 Release 5.9 accounting
CG7406 2008-12-18 5.12 accounting

Clone Sequence Records

RE04580.complete Sequence

823 bp (823 high quality bases) assembled on 2002-02-22

GenBank Submission: AY089569

> RE04580.complete
ATCGGTTTCCGAGCTAAGCTCCCACAACCCACTTCGACCATCGCCAAGTG
CCAGTTAAACCCAAGTGTAACCGACAACAATATGAAGGTTTTCATCTGCC
TGATTGCCTGCTTCAGCCTGGCCCAATCCGGATTCATCGGAGGCGGCGCT
AGCGGTGGCTGGTCAACTGGAGGAGGTGGTGGCTGGTCATCCGGCGGAGG
CGGCGCCCCCACAATCGTCAAGGTCATCAGCGAGGAGGCTGGTCATGGCG
GATGGGCCGGCGGCTACTCTGGTGGCTATGCCCATGCTCCCGAGGAGGTG
AAGATCGTCAAGGTGATCAGCGAGGCGGGCCACTCTCACGGACATGATTA
TGGTCACAGCCACGGCCACGGCTCGGATGTTAAGATCATCAAGGTCATCC
AGGAGGAGGGTCACAGCCATGGCCATGGCCACGGTTACGACTACTCCAGC
GGAGGCCATGGACACGCACACCACGCCGAAGATGTGAAGATCATTAAGCT
GATCAGCTCCGGAATCGCCGATGGCAGCAGCCACGGTGGCTGGTCGTCCG
GCGGCGGCTGGTTCTCCGGTGGCTCCGGATGGAACTAAGCAGTTCCTCGG
AGATGCTCGGACATTCCAACAGATGCCAGGCAACCCAGTGCGCTGATGTC
AACTCTTTTGTTCCTGTTGTCGGAGTTGTGCGGCGATATTGGCCTTTTTC
GATGCTCGAAGTTAGTTTAGGACAGCGCACGCGTTTTGTGTGTGCGCTTA
GAAACCATTAATTTTTTTTGCTAATTTTTAAAGAAATACACAGAAAATGA
AAAAGATAAAAAAAAAAAAAAAA

RE04580.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG7406-RA 947 CG7406-RA 66..874 1..809 4015 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:17:43
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18966764..18967481 86..803 3560 99.7 Plus
chrX 22417052 chrX 18966618..18966706 1..89 430 98.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:27:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19077871..19078594 86..809 3605 99.9 Plus
X 23542271 X 19077725..19077813 1..89 430 98.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19085969..19086692 86..809 3605 99.8 Plus
X 23527363 X 19085823..19085911 1..89 430 98.8 Plus
Blast to na_te.dros performed on 2019-03-16 06:17:42 has no hits.

RE04580.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:18:46 Download gff for RE04580.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18966618..18966704 1..87 98 -> Plus
chrX 18966766..18967484 88..807 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:48:36 Download gff for RE04580.complete
Subject Subject Range Query Range Percent Splice Strand
CG7406-RA 1..507 82..588 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:01:22 Download gff for RE04580.complete
Subject Subject Range Query Range Percent Splice Strand
CG7406-RA 1..507 82..588 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:39:01 Download gff for RE04580.complete
Subject Subject Range Query Range Percent Splice Strand
CG7406-RA 1..507 82..588 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:22:06 Download gff for RE04580.complete
Subject Subject Range Query Range Percent Splice Strand
CG7406-RA 1..507 82..588 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:19:57 Download gff for RE04580.complete
Subject Subject Range Query Range Percent Splice Strand
CG7406-RA 1..507 82..588 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:50:27 Download gff for RE04580.complete
Subject Subject Range Query Range Percent Splice Strand
CG7406-RA 1..807 1..807 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:01:22 Download gff for RE04580.complete
Subject Subject Range Query Range Percent Splice Strand
CG7406-RA 1..807 1..807 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:39:01 Download gff for RE04580.complete
Subject Subject Range Query Range Percent Splice Strand
CG7406-RA 1..807 1..807 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:22:06 Download gff for RE04580.complete
Subject Subject Range Query Range Percent Splice Strand
CG7406-RA 1..807 1..807 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:19:57 Download gff for RE04580.complete
Subject Subject Range Query Range Percent Splice Strand
CG7406-RA 6..812 1..807 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:18:46 Download gff for RE04580.complete
Subject Subject Range Query Range Percent Splice Strand
X 19077725..19077811 1..87 98 -> Plus
X 19077873..19078592 88..807 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:18:46 Download gff for RE04580.complete
Subject Subject Range Query Range Percent Splice Strand
X 19077725..19077811 1..87 98 -> Plus
X 19077873..19078592 88..807 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:18:46 Download gff for RE04580.complete
Subject Subject Range Query Range Percent Splice Strand
X 19077725..19077811 1..87 98 -> Plus
X 19077873..19078592 88..807 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:39:01 Download gff for RE04580.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18971758..18971844 1..87 98 -> Plus
arm_X 18971906..18972625 88..807 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:08:25 Download gff for RE04580.complete
Subject Subject Range Query Range Percent Splice Strand
X 19085971..19086690 88..807 99   Plus
X 19085823..19085909 1..87 98 -> Plus

RE04580.hyp Sequence

Translation from 0 to 587

> RE04580.hyp
ISFRAKLPQPTSTIAKCQLNPSVTDNNMKVFICLIACFSLAQSGFIGGGA
SGGWSTGGGGGWSSGGGGAPTIVKVISEEAGHGGWAGGYSGGYAHAPEEV
KIVKVISEAGHSHGHDYGHSHGHGSDVKIIKVIQEEGHSHGHGHGYDYSS
GGHGHAHHAEDVKIIKLISSGIADGSSHGGWSSGGGWFSGGSGWN*

RE04580.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:18:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG7406-PA 168 CG7406-PA 1..168 28..195 942 100 Plus
CG15731-PA 319 CG15731-PA 1..200 28..191 321 40.5 Plus
CG14191-PA 193 CG14191-PA 1..188 28..187 273 39.2 Plus
CG12523-PB 250 CG12523-PB 1..193 28..194 263 38.8 Plus
CG12523-PA 250 CG12523-PA 1..193 28..194 263 38.8 Plus
CG15731-PA 319 CG15731-PA 81..264 47..187 262 41.2 Plus
CG15731-PA 319 CG15731-PA 185..284 49..143 246 57.8 Plus
CG15731-PA 319 CG15731-PA 149..283 42..157 237 43.5 Plus

RE04580.pep Sequence

Translation from 81 to 587

> RE04580.pep
MKVFICLIACFSLAQSGFIGGGASGGWSTGGGGGWSSGGGGAPTIVKVIS
EEAGHGGWAGGYSGGYAHAPEEVKIVKVISEAGHSHGHDYGHSHGHGSDV
KIIKVIQEEGHSHGHGHGYDYSSGGHGHAHHAEDVKIIKLISSGIADGSS
HGGWSSGGGWFSGGSGWN*

RE04580.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:23:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19207-PA 146 GG19207-PA 1..108 1..106 213 70.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG7406-PA 168 CG7406-PA 1..168 1..168 942 100 Plus
CG15731-PA 319 CG15731-PA 1..200 1..164 321 40.5 Plus
CG14191-PA 193 CG14191-PA 1..188 1..160 273 39.2 Plus
CG12523-PB 250 CG12523-PB 1..193 1..167 263 38.8 Plus
CG12523-PA 250 CG12523-PA 1..193 1..167 263 38.8 Plus
CG15731-PA 319 CG15731-PA 81..264 20..160 262 41.2 Plus
CG15731-PA 319 CG15731-PA 185..284 22..116 246 57.8 Plus
CG13376-PB 200 CG13376-PB 1..199 1..167 242 36.8 Plus
CG15731-PA 319 CG15731-PA 149..283 15..130 237 43.5 Plus
CG13376-PC 193 CG13376-PC 18..192 16..167 235 39 Plus
CG13376-PD 204 CG13376-PD 29..203 16..167 235 39 Plus
CG15597-PB 149 CG15597-PB 1..146 1..161 219 35 Plus
Ipod-PC 349 CG2961-PC 1..152 1..146 209 34.5 Plus
Ipod-PB 349 CG2961-PB 1..152 1..146 209 34.5 Plus
Ipod-PA 349 CG2961-PA 1..152 1..146 209 34.5 Plus
CG9083-PB 317 CG9083-PB 53..224 20..165 191 38.9 Plus
CG13376-PD 204 CG13376-PD 1..157 1..166 188 36.6 Plus
CG2962-PA 376 CG2962-PA 1..214 1..165 188 32.7 Plus
CG13376-PC 193 CG13376-PC 15..146 30..166 187 40.3 Plus
CG5172-PD 172 CG5172-PD 8..161 3..166 179 33.1 Plus
CG9083-PB 317 CG9083-PB 37..184 24..164 170 36.9 Plus
CG10597-PB 200 CG10597-PB 1..159 1..167 167 32 Plus
Cpr35B-PA 218 CG3474-PA 139..218 50..131 166 40.4 Plus
CG34327-PA 220 CG34327-PA 62..219 17..168 164 33.1 Plus
CG32564-PA 409 CG32564-PA 34..144 19..126 163 35.8 Plus
CG10598-PC 173 CG10598-PC 1..170 1..168 160 31.4 Plus
CG10598-PA 173 CG10598-PA 1..170 1..168 160 31.4 Plus
CG34327-PA 220 CG34327-PA 23..184 19..168 158 33.1 Plus
CG9083-PB 317 CG9083-PB 95..268 17..166 148 32.2 Plus
CG9083-PB 317 CG9083-PB 123..316 2..167 147 28.3 Plus
CG17108-PA 342 CG17108-PA 1..180 1..166 146 30.8 Plus
CG5070-PA 209 CG5070-PA 11..156 7..166 145 27.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:23:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22939-PA 174 GM22939-PA 1..153 1..147 372 84.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:23:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17423-PA 87 GD17423-PA 1..85 1..75 141 80 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:23:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25700-PA 206 GK25700-PA 1..176 1..144 157 45.9 Plus
Dwil\GK15091-PA 188 GK15091-PA 1..161 1..144 141 43.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:24:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17771-PA 189 GE17771-PA 1..172 1..147 270 69.2 Plus