RE04580.complete Sequence
823 bp (823 high quality bases) assembled on 2002-02-22
GenBank Submission: AY089569
> RE04580.complete
ATCGGTTTCCGAGCTAAGCTCCCACAACCCACTTCGACCATCGCCAAGTG
CCAGTTAAACCCAAGTGTAACCGACAACAATATGAAGGTTTTCATCTGCC
TGATTGCCTGCTTCAGCCTGGCCCAATCCGGATTCATCGGAGGCGGCGCT
AGCGGTGGCTGGTCAACTGGAGGAGGTGGTGGCTGGTCATCCGGCGGAGG
CGGCGCCCCCACAATCGTCAAGGTCATCAGCGAGGAGGCTGGTCATGGCG
GATGGGCCGGCGGCTACTCTGGTGGCTATGCCCATGCTCCCGAGGAGGTG
AAGATCGTCAAGGTGATCAGCGAGGCGGGCCACTCTCACGGACATGATTA
TGGTCACAGCCACGGCCACGGCTCGGATGTTAAGATCATCAAGGTCATCC
AGGAGGAGGGTCACAGCCATGGCCATGGCCACGGTTACGACTACTCCAGC
GGAGGCCATGGACACGCACACCACGCCGAAGATGTGAAGATCATTAAGCT
GATCAGCTCCGGAATCGCCGATGGCAGCAGCCACGGTGGCTGGTCGTCCG
GCGGCGGCTGGTTCTCCGGTGGCTCCGGATGGAACTAAGCAGTTCCTCGG
AGATGCTCGGACATTCCAACAGATGCCAGGCAACCCAGTGCGCTGATGTC
AACTCTTTTGTTCCTGTTGTCGGAGTTGTGCGGCGATATTGGCCTTTTTC
GATGCTCGAAGTTAGTTTAGGACAGCGCACGCGTTTTGTGTGTGCGCTTA
GAAACCATTAATTTTTTTTGCTAATTTTTAAAGAAATACACAGAAAATGA
AAAAGATAAAAAAAAAAAAAAAA
RE04580.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:48:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7406-RA | 947 | CG7406-RA | 66..874 | 1..809 | 4015 | 99.7 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:17:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrX | 22417052 | chrX | 18966764..18967481 | 86..803 | 3560 | 99.7 | Plus |
chrX | 22417052 | chrX | 18966618..18966706 | 1..89 | 430 | 98.9 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:27:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:17:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 19077871..19078594 | 86..809 | 3605 | 99.9 | Plus |
X | 23542271 | X | 19077725..19077813 | 1..89 | 430 | 98.9 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:41:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 19085969..19086692 | 86..809 | 3605 | 99.8 | Plus |
X | 23527363 | X | 19085823..19085911 | 1..89 | 430 | 98.8 | Plus |
Blast to na_te.dros performed on 2019-03-16 06:17:42 has no hits.
RE04580.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:18:46 Download gff for
RE04580.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chrX | 18966618..18966704 | 1..87 | 98 | -> | Plus |
chrX | 18966766..18967484 | 88..807 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:48:36 Download gff for
RE04580.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7406-RA | 1..507 | 82..588 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:01:22 Download gff for
RE04580.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7406-RA | 1..507 | 82..588 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:39:01 Download gff for
RE04580.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7406-RA | 1..507 | 82..588 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:22:06 Download gff for
RE04580.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7406-RA | 1..507 | 82..588 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:19:57 Download gff for
RE04580.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7406-RA | 1..507 | 82..588 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:50:27 Download gff for
RE04580.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7406-RA | 1..807 | 1..807 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:01:22 Download gff for
RE04580.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7406-RA | 1..807 | 1..807 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:39:01 Download gff for
RE04580.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7406-RA | 1..807 | 1..807 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:22:06 Download gff for
RE04580.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7406-RA | 1..807 | 1..807 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:19:57 Download gff for
RE04580.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7406-RA | 6..812 | 1..807 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:18:46 Download gff for
RE04580.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 19077725..19077811 | 1..87 | 98 | -> | Plus |
X | 19077873..19078592 | 88..807 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:18:46 Download gff for
RE04580.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 19077725..19077811 | 1..87 | 98 | -> | Plus |
X | 19077873..19078592 | 88..807 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:18:46 Download gff for
RE04580.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 19077725..19077811 | 1..87 | 98 | -> | Plus |
X | 19077873..19078592 | 88..807 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:39:01 Download gff for
RE04580.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 18971758..18971844 | 1..87 | 98 | -> | Plus |
arm_X | 18971906..18972625 | 88..807 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:08:25 Download gff for
RE04580.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 19085971..19086690 | 88..807 | 99 | | Plus |
X | 19085823..19085909 | 1..87 | 98 | -> | Plus |
RE04580.hyp Sequence
Translation from 0 to 587
> RE04580.hyp
ISFRAKLPQPTSTIAKCQLNPSVTDNNMKVFICLIACFSLAQSGFIGGGA
SGGWSTGGGGGWSSGGGGAPTIVKVISEEAGHGGWAGGYSGGYAHAPEEV
KIVKVISEAGHSHGHDYGHSHGHGSDVKIIKVIQEEGHSHGHGHGYDYSS
GGHGHAHHAEDVKIIKLISSGIADGSSHGGWSSGGGWFSGGSGWN*
RE04580.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:18:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7406-PA | 168 | CG7406-PA | 1..168 | 28..195 | 942 | 100 | Plus |
CG15731-PA | 319 | CG15731-PA | 1..200 | 28..191 | 321 | 40.5 | Plus |
CG14191-PA | 193 | CG14191-PA | 1..188 | 28..187 | 273 | 39.2 | Plus |
CG12523-PB | 250 | CG12523-PB | 1..193 | 28..194 | 263 | 38.8 | Plus |
CG12523-PA | 250 | CG12523-PA | 1..193 | 28..194 | 263 | 38.8 | Plus |
CG15731-PA | 319 | CG15731-PA | 81..264 | 47..187 | 262 | 41.2 | Plus |
CG15731-PA | 319 | CG15731-PA | 185..284 | 49..143 | 246 | 57.8 | Plus |
CG15731-PA | 319 | CG15731-PA | 149..283 | 42..157 | 237 | 43.5 | Plus |
RE04580.pep Sequence
Translation from 81 to 587
> RE04580.pep
MKVFICLIACFSLAQSGFIGGGASGGWSTGGGGGWSSGGGGAPTIVKVIS
EEAGHGGWAGGYSGGYAHAPEEVKIVKVISEAGHSHGHDYGHSHGHGSDV
KIIKVIQEEGHSHGHGHGYDYSSGGHGHAHHAEDVKIIKLISSGIADGSS
HGGWSSGGGWFSGGSGWN*
RE04580.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:23:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG19207-PA | 146 | GG19207-PA | 1..108 | 1..106 | 213 | 70.2 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7406-PA | 168 | CG7406-PA | 1..168 | 1..168 | 942 | 100 | Plus |
CG15731-PA | 319 | CG15731-PA | 1..200 | 1..164 | 321 | 40.5 | Plus |
CG14191-PA | 193 | CG14191-PA | 1..188 | 1..160 | 273 | 39.2 | Plus |
CG12523-PB | 250 | CG12523-PB | 1..193 | 1..167 | 263 | 38.8 | Plus |
CG12523-PA | 250 | CG12523-PA | 1..193 | 1..167 | 263 | 38.8 | Plus |
CG15731-PA | 319 | CG15731-PA | 81..264 | 20..160 | 262 | 41.2 | Plus |
CG15731-PA | 319 | CG15731-PA | 185..284 | 22..116 | 246 | 57.8 | Plus |
CG13376-PB | 200 | CG13376-PB | 1..199 | 1..167 | 242 | 36.8 | Plus |
CG15731-PA | 319 | CG15731-PA | 149..283 | 15..130 | 237 | 43.5 | Plus |
CG13376-PC | 193 | CG13376-PC | 18..192 | 16..167 | 235 | 39 | Plus |
CG13376-PD | 204 | CG13376-PD | 29..203 | 16..167 | 235 | 39 | Plus |
CG15597-PB | 149 | CG15597-PB | 1..146 | 1..161 | 219 | 35 | Plus |
Ipod-PC | 349 | CG2961-PC | 1..152 | 1..146 | 209 | 34.5 | Plus |
Ipod-PB | 349 | CG2961-PB | 1..152 | 1..146 | 209 | 34.5 | Plus |
Ipod-PA | 349 | CG2961-PA | 1..152 | 1..146 | 209 | 34.5 | Plus |
CG9083-PB | 317 | CG9083-PB | 53..224 | 20..165 | 191 | 38.9 | Plus |
CG13376-PD | 204 | CG13376-PD | 1..157 | 1..166 | 188 | 36.6 | Plus |
CG2962-PA | 376 | CG2962-PA | 1..214 | 1..165 | 188 | 32.7 | Plus |
CG13376-PC | 193 | CG13376-PC | 15..146 | 30..166 | 187 | 40.3 | Plus |
CG5172-PD | 172 | CG5172-PD | 8..161 | 3..166 | 179 | 33.1 | Plus |
CG9083-PB | 317 | CG9083-PB | 37..184 | 24..164 | 170 | 36.9 | Plus |
CG10597-PB | 200 | CG10597-PB | 1..159 | 1..167 | 167 | 32 | Plus |
Cpr35B-PA | 218 | CG3474-PA | 139..218 | 50..131 | 166 | 40.4 | Plus |
CG34327-PA | 220 | CG34327-PA | 62..219 | 17..168 | 164 | 33.1 | Plus |
CG32564-PA | 409 | CG32564-PA | 34..144 | 19..126 | 163 | 35.8 | Plus |
CG10598-PC | 173 | CG10598-PC | 1..170 | 1..168 | 160 | 31.4 | Plus |
CG10598-PA | 173 | CG10598-PA | 1..170 | 1..168 | 160 | 31.4 | Plus |
CG34327-PA | 220 | CG34327-PA | 23..184 | 19..168 | 158 | 33.1 | Plus |
CG9083-PB | 317 | CG9083-PB | 95..268 | 17..166 | 148 | 32.2 | Plus |
CG9083-PB | 317 | CG9083-PB | 123..316 | 2..167 | 147 | 28.3 | Plus |
CG17108-PA | 342 | CG17108-PA | 1..180 | 1..166 | 146 | 30.8 | Plus |
CG5070-PA | 209 | CG5070-PA | 11..156 | 7..166 | 145 | 27.6 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:23:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM22939-PA | 174 | GM22939-PA | 1..153 | 1..147 | 372 | 84.3 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:23:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD17423-PA | 87 | GD17423-PA | 1..85 | 1..75 | 141 | 80 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:23:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK25700-PA | 206 | GK25700-PA | 1..176 | 1..144 | 157 | 45.9 | Plus |
Dwil\GK15091-PA | 188 | GK15091-PA | 1..161 | 1..144 | 141 | 43.6 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:24:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE17771-PA | 189 | GE17771-PA | 1..172 | 1..147 | 270 | 69.2 | Plus |