Clone RE04845 Report

Search the DGRC for RE04845

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:48
Well:45
Vector:pFlc-1
Associated Gene/TranscriptCG1941-RA
Protein status:RE04845.pep: gold
Preliminary Size:1059
Sequenced Size:1277

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1941 2002-01-01 Sim4 clustering to Release 2
CG1941 2002-01-03 Blastp of sequenced clone
CG1941 2003-01-01 Sim4 clustering to Release 3
CG1941 2008-04-29 Release 5.5 accounting
CG1941 2008-08-15 Release 5.9 accounting
CG1941 2008-12-18 5.12 accounting

Clone Sequence Records

RE04845.complete Sequence

1277 bp (1277 high quality bases) assembled on 2002-01-03

GenBank Submission: AY075443

> RE04845.complete
AGTTAAATGTTGTACGCTCGCATCGTCGGTTCTGCTGCTCAAACGCGATA
ACGATCCATTACTCGCCGGAGGACCGTGCTACCAAGTAGTTCAACTTTCC
GAGTTCGAGAGCTCTGACATCATGAAAATCGAGTGGGCTCCCAAAGGAGT
TCCCATGGAACGGCGTCGCCAGACGTTTGCCATGGCCTTCCTAATCCTAT
CCTTTATGATACTCTCCTTTGGATCCTATTTCTTCGTTGCTGCCGTGCTG
TTCTATGGAAGCCTTTTGTGGCGCACCATTATGGTCATCTATTTGGTCTA
CGTCTACGCGAATCACAAGAGAACCCACTCCATTATGGATGGCAATGGCT
GGAAAATTAACCGCAACAATTGGCTGTTTCGGCATTATCGGGACTACTTT
CCCGTACAGCTGGTCAAGACCGCAGAGCTGCCGCCGAATAAGAACTACAT
TTTGGCCAGTTTTCCGCACGGAATTTTGGGGACTGGCATTTCCATTAATA
TGGGTCTAGACATCTCCAAGTGGCTGCAACTGTTCCCACAGGTGAGGCCC
AAGGTGGCCACTTTGGATCAAAACTTCCTGACGCCCATCGTGCGTGGTCT
CCTGAGATCTTGGGGCCTGGTGTCGGTTTCCAAGGAGGCCTTAGTATATC
TGCTGACCAAATCAAACGATCCCAAGCACAAGGACAATCGTGATGGGTTC
ACCTCCAACGCGGTGGCTATTCTGGTGGGTGGTGCCCAGGAGGCACTAGA
CTCGCACCCTGGCAAATATATATTGACACTGAAGAACCGCAAGGGATTCG
TTAAAATGGCCATTAGGACAGGGTCTTCGATTGTTCCCACGTTTTCCTTT
GGCGAGGTGGACATTCTGGATCAGGTTGCCAATCCACCGAACTCTCGGGT
TCGTCGCTTTCAAGACTTTGTAAAGAGGATAACGGGGATATCTCCGCTGA
TTCCCGTTGGCCGGGGCATCTTCAACTACTCCTTTGGCTTTCTGCCCAAC
CGTCGACGCATTGTCCAAGTTGTTGGCGCTCCCATCGACGTGGTTCAGAG
CGATCAACCAGACGCAGCCTATGTGGATAAGATACACAAACAGGTTATTG
ACGACCTGGAGAAGATGTTCGCCAAGTACAAGGATCAGTACATACCGAAC
TCCAAGCAGGACAAGCTGATTATACACTAGTCGAGAAGTTATTGTCTAAA
CAATGTGATCAAATGAGTGCTTTATAAGCATTTAATATAAAAATTACGAA
TTTTATCAGGCAAAAAAAAAAAAAAAA

RE04845.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:33:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG1941-RA 1444 CG1941-RA 8..1276 1..1269 6315 99.8 Plus
CG1941.b 1791 CG1941.b 417..1623 63..1269 6005 99.8 Plus
CG1941.a 1528 CG1941.a 154..1360 63..1269 6005 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:28:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3598392..3598736 480..824 1710 99.7 Plus
chr2R 21145070 chr2R 3599060..3599299 1022..1261 1200 100 Plus
chr2R 21145070 chr2R 3598794..3598994 822..1022 1005 100 Plus
chr2R 21145070 chr2R 3597775..3597962 63..250 940 100 Plus
chr2R 21145070 chr2R 3598166..3598299 348..481 670 100 Plus
chr2R 21145070 chr2R 3598013..3598111 250..348 495 100 Plus
chr2R 21145070 chr2R 3600627..3600966 485..824 455 75.6 Plus
chr2R 21145070 chr2R 3601026..3601221 827..1022 440 81.6 Plus
chr2R 21145070 chr2R 3597192..3597253 1..62 310 100 Plus
chr2R 21145070 chr2R 3603198..3603526 482..810 310 72.9 Plus
chr2R 21145070 chr2R 3603601..3603796 827..1022 260 75.5 Plus
chr2R 21145070 chr2R 3600455..3600557 379..481 230 81.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:27:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:28:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7711074..7711418 480..824 1710 99.7 Plus
2R 25286936 2R 7711742..7711989 1022..1269 1225 99.6 Plus
2R 25286936 2R 7711476..7711676 822..1022 1005 100 Plus
2R 25286936 2R 7710457..7710644 63..250 940 100 Plus
2R 25286936 2R 7710848..7710981 348..481 670 100 Plus
2R 25286936 2R 7710695..7710793 250..348 495 100 Plus
2R 25286936 2R 7713309..7713648 485..824 440 75.3 Plus
2R 25286936 2R 7713708..7713903 827..1022 425 81.1 Plus
2R 25286936 2R 7709874..7709935 1..62 310 100 Plus
2R 25286936 2R 7715880..7716208 482..810 295 72.6 Plus
2R 25286936 2R 7716283..7716478 827..1022 260 75.5 Plus
2R 25286936 2R 7713137..7713239 379..481 230 81.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:01:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7712273..7712617 480..824 1710 99.7 Plus
2R 25260384 2R 7712941..7713188 1022..1269 1225 99.5 Plus
2R 25260384 2R 7712675..7712875 822..1022 1005 100 Plus
2R 25260384 2R 7711656..7711843 63..250 940 100 Plus
2R 25260384 2R 7712047..7712180 348..481 670 100 Plus
2R 25260384 2R 7711894..7711992 250..348 495 100 Plus
2R 25260384 2R 7714907..7715102 827..1022 425 81.1 Plus
2R 25260384 2R 7714674..7714847 651..824 345 79.8 Plus
2R 25260384 2R 7711073..7711134 1..62 310 100 Plus
2R 25260384 2R 7714336..7714438 379..481 230 81.5 Plus
2R 25260384 2R 7717482..7717549 827..894 190 85.2 Plus
2R 25260384 2R 7714508..7714593 485..570 160 79 Plus
2R 25260384 2R 7715161..7715280 1022..1141 150 75 Plus
Blast to na_te.dros performed on 2019-03-16 06:28:54 has no hits.

RE04845.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:29:50 Download gff for RE04845.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3599061..3599299 1023..1261 100   Plus
chr2R 3598393..3598734 481..822 99 -> Plus
chr2R 3597192..3597253 1..62 100 -> Plus
chr2R 3597775..3597962 63..250 100 -> Plus
chr2R 3598014..3598111 251..348 100 -> Plus
chr2R 3598167..3598298 349..480 100 -> Plus
chr2R 3598795..3598994 823..1022 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:48:43 Download gff for RE04845.complete
Subject Subject Range Query Range Percent Splice Strand
CG1941-RA 1..1059 122..1180 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:56:00 Download gff for RE04845.complete
Subject Subject Range Query Range Percent Splice Strand
CG1941-RA 1..1059 122..1180 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:39:14 Download gff for RE04845.complete
Subject Subject Range Query Range Percent Splice Strand
CG1941-RB 1..1059 122..1180 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:20:52 Download gff for RE04845.complete
Subject Subject Range Query Range Percent Splice Strand
CG1941-RA 1..1059 122..1180 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:21:29 Download gff for RE04845.complete
Subject Subject Range Query Range Percent Splice Strand
CG1941-RB 1..1059 122..1180 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:20:02 Download gff for RE04845.complete
Subject Subject Range Query Range Percent Splice Strand
CG1941-RA 1..1261 1..1261 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:56:00 Download gff for RE04845.complete
Subject Subject Range Query Range Percent Splice Strand
CG1941-RA 1..1261 1..1261 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:39:14 Download gff for RE04845.complete
Subject Subject Range Query Range Percent Splice Strand
CG1941-RA 2..1262 1..1261 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:20:52 Download gff for RE04845.complete
Subject Subject Range Query Range Percent Splice Strand
CG1941-RA 1..1261 1..1261 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:21:29 Download gff for RE04845.complete
Subject Subject Range Query Range Percent Splice Strand
CG1941-RA 2..1262 1..1261 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:29:50 Download gff for RE04845.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7709874..7709935 1..62 100 -> Plus
2R 7710457..7710644 63..250 100 -> Plus
2R 7710696..7710793 251..348 100 -> Plus
2R 7710849..7710980 349..480 100 -> Plus
2R 7711075..7711416 481..822 99 -> Plus
2R 7711477..7711676 823..1022 100 -> Plus
2R 7711743..7711981 1023..1261 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:29:50 Download gff for RE04845.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7709874..7709935 1..62 100 -> Plus
2R 7710457..7710644 63..250 100 -> Plus
2R 7710696..7710793 251..348 100 -> Plus
2R 7710849..7710980 349..480 100 -> Plus
2R 7711075..7711416 481..822 99 -> Plus
2R 7711477..7711676 823..1022 100 -> Plus
2R 7711743..7711981 1023..1261 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:29:50 Download gff for RE04845.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7709874..7709935 1..62 100 -> Plus
2R 7710457..7710644 63..250 100 -> Plus
2R 7710696..7710793 251..348 100 -> Plus
2R 7710849..7710980 349..480 100 -> Plus
2R 7711075..7711416 481..822 99 -> Plus
2R 7711477..7711676 823..1022 100 -> Plus
2R 7711743..7711981 1023..1261 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:39:14 Download gff for RE04845.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3598201..3598298 251..348 100 -> Plus
arm_2R 3598354..3598485 349..480 100 -> Plus
arm_2R 3597379..3597440 1..62 100 -> Plus
arm_2R 3597962..3598149 63..250 100 -> Plus
arm_2R 3598580..3598921 481..822 99 -> Plus
arm_2R 3598982..3599181 823..1022 100 -> Plus
arm_2R 3599248..3599486 1023..1261 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:55:30 Download gff for RE04845.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7712274..7712615 481..822 99 -> Plus
2R 7712676..7712875 823..1022 100 -> Plus
2R 7712942..7713180 1023..1261 100   Plus
2R 7711073..7711134 1..62 100 -> Plus
2R 7711656..7711843 63..250 100 -> Plus
2R 7711895..7711992 251..348 100 -> Plus
2R 7712048..7712179 349..480 100 -> Plus

RE04845.hyp Sequence

Translation from 0 to 1179

> RE04845.hyp
VKCCTLASSVLLLKRDNDPLLAGGPCYQVVQLSEFESSDIMKIEWAPKGV
PMERRRQTFAMAFLILSFMILSFGSYFFVAAVLFYGSLLWRTIMVIYLVY
VYANHKRTHSIMDGNGWKINRNNWLFRHYRDYFPVQLVKTAELPPNKNYI
LASFPHGILGTGISINMGLDISKWLQLFPQVRPKVATLDQNFLTPIVRGL
LRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFTSNAVAILVGGAQEALD
SHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNSRV
RRFQDFVKRITGISPLIPVGRGIFNYSFGFLPNRRRIVQVVGAPIDVVQS
DQPDAAYVDKIHKQVIDDLEKMFAKYKDQYIPNSKQDKLIIH*

RE04845.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG1941-PD 352 CG1941-PD 1..352 41..392 1837 100 Plus
CG1941-PC 352 CG1941-PC 1..352 41..392 1837 100 Plus
CG1941-PB 352 CG1941-PB 1..352 41..392 1837 100 Plus
CG1941-PA 352 CG1941-PA 1..352 41..392 1837 100 Plus
CG1942-PA 352 CG1942-PA 1..352 41..392 1376 73 Plus

RE04845.pep Sequence

Translation from 121 to 1179

> RE04845.pep
MKIEWAPKGVPMERRRQTFAMAFLILSFMILSFGSYFFVAAVLFYGSLLW
RTIMVIYLVYVYANHKRTHSIMDGNGWKINRNNWLFRHYRDYFPVQLVKT
AELPPNKNYILASFPHGILGTGISINMGLDISKWLQLFPQVRPKVATLDQ
NFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFTSNAVAI
LVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILD
QVANPPNSRVRRFQDFVKRITGISPLIPVGRGIFNYSFGFLPNRRRIVQV
VGAPIDVVQSDQPDAAYVDKIHKQVIDDLEKMFAKYKDQYIPNSKQDKLI
IH*

RE04845.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:53:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13197-PA 352 GF13197-PA 1..352 1..352 1642 85.8 Plus
Dana\GF13198-PA 352 GF13198-PA 1..352 1..352 1293 69.9 Plus
Dana\GF13199-PA 351 GF13199-PA 1..351 1..352 1251 67 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23298-PA 352 GG23298-PA 1..352 1..352 1796 96.3 Plus
Dere\GG23299-PA 352 GG23299-PA 1..352 1..352 1403 72.7 Plus
Dere\GG23300-PA 349 GG23300-PA 1..349 1..352 1267 67 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20316-PA 352 GH20316-PA 1..352 1..352 1320 70.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG1941-PD 352 CG1941-PD 1..352 1..352 1837 100 Plus
CG1941-PC 352 CG1941-PC 1..352 1..352 1837 100 Plus
CG1941-PB 352 CG1941-PB 1..352 1..352 1837 100 Plus
CG1941-PA 352 CG1941-PA 1..352 1..352 1837 100 Plus
Dgat2-PA 352 CG1942-PA 1..352 1..352 1376 73 Plus
CG1946-PA 349 CG1946-PA 1..348 1..351 1254 66.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:53:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19988-PA 352 GI19988-PA 1..352 1..352 1142 61.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:53:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10526-PA 352 GL10526-PA 1..352 1..352 1441 73.9 Plus
Dper\GL10527-PA 352 GL10527-PA 1..352 1..352 1421 74.7 Plus
Dper\GL10836-PA 352 GL10836-PA 1..352 1..352 1407 72.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:53:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15143-PA 352 GA15143-PA 1..352 1..352 1435 73.6 Plus
Dpse\GA24395-PA 352 GA24395-PA 1..352 1..352 1425 74.7 Plus
Dpse\GA15142-PA 352 GA15142-PA 1..352 1..352 1403 72.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:53:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20976-PA 352 GM20976-PA 1..352 1..352 1821 97.2 Plus
Dsec\GM20977-PA 352 GM20977-PA 1..352 1..352 1404 72.4 Plus
Dsec\GM20978-PA 349 GM20978-PA 1..349 1..352 1274 67.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:53:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10504-PA 352 GD10504-PA 1..352 1..352 1818 97.4 Plus
Dsim\GD10505-PA 352 GD10505-PA 1..352 1..352 1408 73 Plus
Dsim\GD15355-PA 349 GD15355-PA 1..349 1..352 1278 67.6 Plus
Dsim\GD10506-PA 349 GD10506-PA 1..349 1..352 1272 67 Plus
Dsim\GD15354-PA 253 GD15354-PA 1..251 1..261 948 68.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:53:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21238-PA 352 GJ21238-PA 1..352 1..352 1377 72.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:53:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21715-PA 352 GK21715-PA 1..352 1..352 1381 72.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:53:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19144-PA 352 GE19144-PA 1..352 1..352 1822 98 Plus
Dyak\GE19145-PA 352 GE19145-PA 1..352 1..352 1419 73.9 Plus
Dyak\GE19146-PA 349 GE19146-PA 1..349 1..352 1270 68.2 Plus