Clone RE05022 Report

Search the DGRC for RE05022

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:50
Well:22
Vector:pFlc-1
Associated Gene/TranscriptRpL7A-RA
Protein status:RE05022.pep: gold
Preliminary Size:1015
Sequenced Size:1077

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3314 2002-01-01 Sim4 clustering to Release 2
CG3314 2002-02-22 Blastp of sequenced clone
CG3314 2003-01-01 Sim4 clustering to Release 3
RpL7A 2008-04-29 Release 5.5 accounting
RpL7A 2008-08-15 Release 5.9 accounting
RpL7A 2008-12-18 5.12 accounting

Clone Sequence Records

RE05022.complete Sequence

1077 bp (1077 high quality bases) assembled on 2002-02-22

GenBank Submission: AY089570

> RE05022.complete
ACTCGATTTCCAACATTGGAACTGCCACTTCCTTTCTTTTTCGTTCCACG
TTTCCGCGAGTATTTCGATACGTTCGTGGTCGTGCTTATCACAGCAACTG
CTTATTTCGGTAGCAAACTTTAAAACCGCTTGAAAATGGTTGTCAAGAAG
CCCAGGCCAAAGAAGAAGCCAGTGACCAAGAAGGTGGCTCCCGCTCCTCT
GGCTGTCAAGAAGCCCGTGGTCAAGAAGGTTGTTAACCAGCTGTTCGAGA
AGCGTCCCAAGAACTTCGGAATCGGCCAGAATGTGCAGCCCAAGCGCGAT
CTGTCCCGTTTCGTTCGCTGGCCCAAATACATCCGGGTGCAGCGTCAAAA
GGCTGTGCTCCAGAAGCGCCTGAAGGTCCCACCACCAATCCACCAGTTCA
GCCAGACTCTGGACAAGACCACCGCCGTGAAGCTGTTCAAGCTGCTGGAG
AAGTACCGCCCCGAGTCGCCGCTGGCCAAGAAGCTGCGCCTGAAGAAGAT
CGCCGAGGCTAAGGCCAAGGGCAAGGATGTGGAGCCCAAGAAGAAGCCCA
GCTATGTGTCCGCCGGTACCAACACGGTGACCAAGCTGATCGAGCAGAAG
AAGGCCCAACTGGTGGTCATTGCCCACGATGTTGATCCTCTGGAGCTGGT
GCTCTTCCTGCCCGCCCTGTGCCGCAAGATGGGCGTGCCCTACTGCATTG
TGAAGGGTAAGGCTCGTCTGGGTCGCCTGGTGCGTCGCAAGACCTGCACC
ACCCTCGCCCTGACCACCGTCGATAACAACGACAAGGCCAACTTCGGCAA
GGTCCTGGAGGCTGTGAAGACCAACTTCAACGAGCGCCACGAGGAGATCC
GTCGCCACTGGGGCGGTGGTATCCTTGGCTCCAAGAGTCTGGCCCGCATC
TCTAAGCTGGAGCGCGCCAAGGCACGCGAGCTTGCCCAGAAGCAGGGTTG
ATTCAATCTGAAGCCGGTCCGGTCCGATGGTGGAGACTTTTAAGTACACA
TGGATGAAATTAGTTGGGCCATGCTCACTGAATTTGATAACTAATAAACT
TTTAAGTGTACAAAAAAAAAAAAAAAA

RE05022.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:48:27
Subject Length Description Subject Range Query Range Score Percent Strand
RpL7A-RA 1331 RpL7A-RA 29..1091 1..1063 5315 100 Plus
RpL7A-RD 1398 RpL7A-RD 146..1158 51..1063 5050 99.9 Plus
RpL7A-RD 1398 RpL7A-RD 28..83 1..56 280 100 Plus
RpL17-RB 912 RpL17-RB 36..91 1..56 205 91 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:58:47
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 6423275..6423692 1061..644 2060 99.5 Minus
chrX 22417052 chrX 6424094..6424465 645..274 1860 100 Minus
chrX 22417052 chrX 6424557..6424683 275..149 635 100 Minus
chrX 22417052 chrX 6424750..6424807 150..93 290 100 Minus
chrX 22417052 chrX 6425488..6425543 56..1 265 98.2 Minus
chrX 22417052 chrX 6425382..6425425 94..51 205 97.7 Minus
chrX 22417052 chrX 6636332..6636387 56..1 190 89.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:28:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:58:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6531014..6531433 1063..644 2100 100 Minus
X 23542271 X 6531835..6532206 645..274 1860 100 Minus
X 23542271 X 6532297..6532423 275..149 635 100 Minus
X 23542271 X 6532490..6532547 150..93 290 100 Minus
X 23542271 X 6533230..6533285 56..1 280 100 Minus
X 23542271 X 6533124..6533167 94..51 205 97.7 Minus
X 23542271 X 6744196..6744251 56..1 205 91.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 6539112..6539531 1063..644 2100 100 Minus
X 23527363 X 6539933..6540304 645..274 1860 100 Minus
X 23527363 X 6540395..6540521 275..149 635 100 Minus
X 23527363 X 6540588..6540645 150..93 290 100 Minus
X 23527363 X 6541328..6541383 56..1 280 100 Minus
X 23527363 X 6541222..6541265 94..51 205 97.7 Minus
X 23527363 X 6752294..6752349 56..1 205 91 Minus
Blast to na_te.dros performed on 2019-03-15 18:58:45 has no hits.

RE05022.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:00:01 Download gff for RE05022.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 6423275..6423690 646..1061 99 <- Minus
chrX 6424094..6424464 275..645 100 <- Minus
chrX 6424558..6424681 151..274 100 <- Minus
chrX 6424750..6424805 95..150 100 <- Minus
chrX 6425382..6425419 57..94 100 <- Minus
chrX 6425488..6425543 1..56 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:48:50 Download gff for RE05022.complete
Subject Subject Range Query Range Percent Splice Strand
RpL7A-RC 1..816 136..951 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:43:06 Download gff for RE05022.complete
Subject Subject Range Query Range Percent Splice Strand
RpL7A-RD 1..816 136..951 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:38:25 Download gff for RE05022.complete
Subject Subject Range Query Range Percent Splice Strand
RpL7A-RD 1..816 136..951 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:22:09 Download gff for RE05022.complete
Subject Subject Range Query Range Percent Splice Strand
RpL7A-RC 1..816 136..951 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:06:58 Download gff for RE05022.complete
Subject Subject Range Query Range Percent Splice Strand
RpL7A-RE 1..816 136..951 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:50:30 Download gff for RE05022.complete
Subject Subject Range Query Range Percent Splice Strand
RpL7A-RA 1..1061 1..1061 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:43:05 Download gff for RE05022.complete
Subject Subject Range Query Range Percent Splice Strand
RpL7A-RA 1..1061 1..1061 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:38:25 Download gff for RE05022.complete
Subject Subject Range Query Range Percent Splice Strand
RpL7A-RA 1..1032 30..1061 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:22:09 Download gff for RE05022.complete
Subject Subject Range Query Range Percent Splice Strand
RpL7A-RA 1..1061 1..1061 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:06:58 Download gff for RE05022.complete
Subject Subject Range Query Range Percent Splice Strand
RpL7A-RA 64..1124 1..1061 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:00:01 Download gff for RE05022.complete
Subject Subject Range Query Range Percent Splice Strand
X 6532298..6532421 151..274 100 <- Minus
X 6532490..6532545 95..150 100 <- Minus
X 6533124..6533161 57..94 100 <- Minus
X 6533230..6533285 1..56 100   Minus
X 6531016..6531431 646..1061 100 <- Minus
X 6531835..6532205 275..645 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:00:01 Download gff for RE05022.complete
Subject Subject Range Query Range Percent Splice Strand
X 6532298..6532421 151..274 100 <- Minus
X 6532490..6532545 95..150 100 <- Minus
X 6533124..6533161 57..94 100 <- Minus
X 6533230..6533285 1..56 100   Minus
X 6531016..6531431 646..1061 100 <- Minus
X 6531835..6532205 275..645 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:00:01 Download gff for RE05022.complete
Subject Subject Range Query Range Percent Splice Strand
X 6532298..6532421 151..274 100 <- Minus
X 6532490..6532545 95..150 100 <- Minus
X 6533124..6533161 57..94 100 <- Minus
X 6533230..6533285 1..56 100   Minus
X 6531016..6531431 646..1061 100 <- Minus
X 6531835..6532205 275..645 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:38:25 Download gff for RE05022.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6425049..6425464 646..1061 100 <- Minus
arm_X 6425868..6426238 275..645 100 <- Minus
arm_X 6426331..6426454 151..274 100 <- Minus
arm_X 6426523..6426578 95..150 100 <- Minus
arm_X 6427157..6427194 57..94 100 <- Minus
arm_X 6427263..6427318 1..56 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:56:45 Download gff for RE05022.complete
Subject Subject Range Query Range Percent Splice Strand
X 6539114..6539529 646..1061 100 <- Minus
X 6539933..6540303 275..645 100 <- Minus
X 6540396..6540519 151..274 100 <- Minus
X 6540588..6540643 95..150 100 <- Minus
X 6541222..6541259 57..94 100 <- Minus
X 6541328..6541383 1..56 100   Minus

RE05022.pep Sequence

Translation from 135 to 950

> RE05022.pep
MVVKKPRPKKKPVTKKVAPAPLAVKKPVVKKVVNQLFEKRPKNFGIGQNV
QPKRDLSRFVRWPKYIRVQRQKAVLQKRLKVPPPIHQFSQTLDKTTAVKL
FKLLEKYRPESPLAKKLRLKKIAEAKAKGKDVEPKKKPSYVSAGTNTVTK
LIEQKKAQLVVIAHDVDPLELVLFLPALCRKMGVPYCIVKGKARLGRLVR
RKTCTTLALTTVDNNDKANFGKVLEAVKTNFNERHEEIRRHWGGGILGSK
SLARISKLERAKARELAQKQG*

RE05022.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:24:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21901-PA 271 GF21901-PA 1..271 1..271 1379 99.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:24:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17670-PA 271 GG17670-PA 1..271 1..271 1384 99.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:24:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12036-PA 271 GH12036-PA 18..271 18..271 1195 94.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:56
Subject Length Description Subject Range Query Range Score Percent Strand
RpL7A-PG 271 CG3314-PG 1..271 1..271 1379 100 Plus
RpL7A-PF 271 CG3314-PF 1..271 1..271 1379 100 Plus
RpL7A-PE 271 CG3314-PE 1..271 1..271 1379 100 Plus
RpL7A-PD 271 CG3314-PD 1..271 1..271 1379 100 Plus
RpL7A-PA 271 CG3314-PA 1..271 1..271 1379 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:24:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16190-PA 271 GI16190-PA 1..271 1..271 1350 96.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14313-PA 271 GL14313-PA 1..271 1..271 1362 97.4 Plus
Dper\GL18200-PA 583 GL18200-PA 397..583 84..271 920 95.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17314-PA 271 GA17314-PA 1..271 1..271 1358 97 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12569-PA 271 GM12569-PA 1..271 1..271 1377 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16190-PA 271 GD16190-PA 1..271 1..271 1390 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16679-PA 271 GJ16679-PA 1..271 1..271 1351 97 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:24:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19722-PA 271 GK19722-PA 1..271 1..271 1354 97 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:24:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpL7A-PA 271 GE16459-PA 1..271 1..271 1390 100 Plus

RE05022.hyp Sequence

Translation from 135 to 950

> RE05022.hyp
MVVKKPRPKKKPVTKKVAPAPLAVKKPVVKKVVNQLFEKRPKNFGIGQNV
QPKRDLSRFVRWPKYIRVQRQKAVLQKRLKVPPPIHQFSQTLDKTTAVKL
FKLLEKYRPESPLAKKLRLKKIAEAKAKGKDVEPKKKPSYVSAGTNTVTK
LIEQKKAQLVVIAHDVDPLELVLFLPALCRKMGVPYCIVKGKARLGRLVR
RKTCTTLALTTVDNNDKANFGKVLEAVKTNFNERHEEIRRHWGGGILGSK
SLARISKLERAKARELAQKQG*

RE05022.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:26:10
Subject Length Description Subject Range Query Range Score Percent Strand
RpL7A-PG 271 CG3314-PG 1..271 1..271 1379 100 Plus
RpL7A-PF 271 CG3314-PF 1..271 1..271 1379 100 Plus
RpL7A-PE 271 CG3314-PE 1..271 1..271 1379 100 Plus
RpL7A-PD 271 CG3314-PD 1..271 1..271 1379 100 Plus
RpL7A-PA 271 CG3314-PA 1..271 1..271 1379 100 Plus