Clone RE05231 Report

Search the DGRC for RE05231

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:52
Well:31
Vector:pFlc-1
Associated Gene/TranscriptCG30197-RA
Protein status:RE05231.pep: gold
Sequenced Size:493

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10117 2002-01-01 Sim4 clustering to Release 2
CG30197 2002-04-22 Blastp of sequenced clone
CG30197 2003-01-01 Sim4 clustering to Release 3
CG30197 2008-04-29 Release 5.5 accounting
CG30197 2008-08-15 Release 5.9 accounting
CG30197 2008-12-18 5.12 accounting

Clone Sequence Records

RE05231.complete Sequence

493 bp (493 high quality bases) assembled on 2002-04-22

GenBank Submission: AY113384

> RE05231.complete
CCGGTCGATGTTAACTATAGTAACGTAGCGGACGTTCAACTATCATCATG
GTTAAGCTCGGCTTTCTTTCACTGTTAATTGCTGCCTGTGTGGTTGCTGC
CTTTGCTGCGGGTGATTGTCCTTCATCCACCAAGGTTCAGAACTGTACGC
CAAAATGCCTGCATGACAGCGAGTGCAGCGCCATCGGCGGAAAATGCTGT
CCGAATTTGTGCAACGGTCGCAGTTGTGCTCAACCGAATGTCCTGGGAAA
TTCTGGAGCCGATAAATCGCCCTTCGGCAGCAAGAACTCTGGAGCTACTG
GCAGTTATTGCGGCAATGTCAAGTGCGGCAGCTTTGAGAAATGCGAAATG
GATCGCAGCACCAAGCGACCCAAGTGCGTGAGATCGTGAAAACCAGGCAG
CAAAATCAACGGACACGGCAGCAATATCACGTTATAAACTCATTAATTTG
TCACTAAATGCAAACTCTTTAGCCCGTAAAAAAAAAAAAAAAA

RE05231.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:22:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG30197-RA 634 CG30197-RA 121..597 4..480 2385 100 Plus
nc_6806.a 798 nc_6806.a 405..579 288..114 875 100 Minus
nc_6806.a 798 nc_6806.a 1..95 383..289 475 100 Minus
nc_6806.a 798 nc_6806.a 646..709 114..51 320 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:58:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10402107..10402295 289..477 945 100 Plus
chr2R 21145070 chr2R 10401585..10401759 114..288 875 100 Plus
chr2R 21145070 chr2R 10401455..10401518 51..114 320 100 Plus
chr2R 21145070 chr2R 10401340..10401387 4..51 240 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:28:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:58:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14514804..14514995 289..480 960 100 Plus
2R 25286936 2R 14514282..14514456 114..288 875 100 Plus
2R 25286936 2R 14514152..14514215 51..114 320 100 Plus
2R 25286936 2R 14514037..14514084 4..51 240 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:14:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14516003..14516194 289..480 960 100 Plus
2R 25260384 2R 14515481..14515655 114..288 875 100 Plus
2R 25260384 2R 14515351..14515414 51..114 320 100 Plus
2R 25260384 2R 14515236..14515283 4..51 240 100 Plus
Blast to na_te.dros performed on 2019-03-15 18:58:48 has no hits.

RE05231.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:00:02 Download gff for RE05231.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10401337..10401387 1..51 98 -> Plus
chr2R 10401456..10401518 52..114 100 -> Plus
chr2R 10401586..10401759 115..288 100 -> Plus
chr2R 10402107..10402295 289..477 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:48:55 Download gff for RE05231.complete
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 1..342 48..389 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:39:33 Download gff for RE05231.complete
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 1..342 48..389 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:38:30 Download gff for RE05231.complete
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 1..342 48..389 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:15:01 Download gff for RE05231.complete
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 1..342 48..389 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:07:02 Download gff for RE05231.complete
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 1..342 48..389 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:11:46 Download gff for RE05231.complete
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 1..477 1..477 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:39:33 Download gff for RE05231.complete
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 1..477 1..477 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:38:30 Download gff for RE05231.complete
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 1..477 1..477 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:15:01 Download gff for RE05231.complete
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 1..477 1..477 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:07:02 Download gff for RE05231.complete
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 5..481 1..477 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:00:02 Download gff for RE05231.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14514034..14514084 1..51 98 -> Plus
2R 14514153..14514215 52..114 100 -> Plus
2R 14514283..14514456 115..288 100 -> Plus
2R 14514804..14514992 289..477 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:00:02 Download gff for RE05231.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14514034..14514084 1..51 98 -> Plus
2R 14514153..14514215 52..114 100 -> Plus
2R 14514283..14514456 115..288 100 -> Plus
2R 14514804..14514992 289..477 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:00:02 Download gff for RE05231.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14514034..14514084 1..51 98 -> Plus
2R 14514153..14514215 52..114 100 -> Plus
2R 14514283..14514456 115..288 100 -> Plus
2R 14514804..14514992 289..477 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:38:30 Download gff for RE05231.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10401539..10401589 1..51 98 -> Plus
arm_2R 10401658..10401720 52..114 100 -> Plus
arm_2R 10401788..10401961 115..288 100 -> Plus
arm_2R 10402309..10402497 289..477 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:02:15 Download gff for RE05231.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14515233..14515283 1..51 98 -> Plus
2R 14515352..14515414 52..114 100 -> Plus
2R 14515482..14515655 115..288 100 -> Plus
2R 14516003..14516191 289..477 100   Plus

RE05231.pep Sequence

Translation from 47 to 388

> RE05231.pep
MVKLGFLSLLIAACVVAAFAAGDCPSSTKVQNCTPKCLHDSECSAIGGKC
CPNLCNGRSCAQPNVLGNSGADKSPFGSKNSGATGSYCGNVKCGSFEKCE
MDRSTKRPKCVRS*

RE05231.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:00:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13511-PA 111 GF13511-PA 1..111 3..113 398 89.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:00:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20463-PA 113 GG20463-PA 1..113 1..113 573 99.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:00:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20786-PA 110 GH20786-PA 3..110 6..113 460 83.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG30197-PA 113 CG30197-PA 1..113 1..113 621 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:00:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20871-PA 116 GI20871-PA 22..116 19..113 455 93.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:00:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11445-PA 113 GL11445-PA 1..113 1..113 526 90.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:00:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15722-PA 113 GA15722-PA 1..113 1..113 526 90.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:00:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21553-PA 92 GM21553-PA 2..92 23..113 463 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:00:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11059-PA 113 GD11059-PA 1..113 1..113 573 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:00:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20606-PA 122 GJ20606-PA 19..122 10..113 473 86.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:00:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15838-PA 166 GK15838-PA 52..166 1..113 483 80.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:00:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13595-PA 113 GE13595-PA 1..113 1..113 576 100 Plus

RE05231.hyp Sequence

Translation from 47 to 388

> RE05231.hyp
MVKLGFLSLLIAACVVAAFAAGDCPSSTKVQNCTPKCLHDSECSAIGGKC
CPNLCNGRSCAQPNVLGNSGADKSPFGSKNSGATGSYCGNVKCGSFEKCE
MDRSTKRPKCVRS*

RE05231.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:05:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG30197-PA 113 CG30197-PA 1..113 1..113 621 100 Plus