BDGP Sequence Production Resources |
Search the DGRC for RE05231
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 52 |
Well: | 31 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG30197-RA |
Protein status: | RE05231.pep: gold |
Sequenced Size: | 493 |
Gene | Date | Evidence |
---|---|---|
CG10117 | 2002-01-01 | Sim4 clustering to Release 2 |
CG30197 | 2002-04-22 | Blastp of sequenced clone |
CG30197 | 2003-01-01 | Sim4 clustering to Release 3 |
CG30197 | 2008-04-29 | Release 5.5 accounting |
CG30197 | 2008-08-15 | Release 5.9 accounting |
CG30197 | 2008-12-18 | 5.12 accounting |
493 bp (493 high quality bases) assembled on 2002-04-22
GenBank Submission: AY113384
> RE05231.complete CCGGTCGATGTTAACTATAGTAACGTAGCGGACGTTCAACTATCATCATG GTTAAGCTCGGCTTTCTTTCACTGTTAATTGCTGCCTGTGTGGTTGCTGC CTTTGCTGCGGGTGATTGTCCTTCATCCACCAAGGTTCAGAACTGTACGC CAAAATGCCTGCATGACAGCGAGTGCAGCGCCATCGGCGGAAAATGCTGT CCGAATTTGTGCAACGGTCGCAGTTGTGCTCAACCGAATGTCCTGGGAAA TTCTGGAGCCGATAAATCGCCCTTCGGCAGCAAGAACTCTGGAGCTACTG GCAGTTATTGCGGCAATGTCAAGTGCGGCAGCTTTGAGAAATGCGAAATG GATCGCAGCACCAAGCGACCCAAGTGCGTGAGATCGTGAAAACCAGGCAG CAAAATCAACGGACACGGCAGCAATATCACGTTATAAACTCATTAATTTG TCACTAAATGCAAACTCTTTAGCCCGTAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG30197-RA | 634 | CG30197-RA | 121..597 | 4..480 | 2385 | 100 | Plus |
nc_6806.a | 798 | nc_6806.a | 405..579 | 288..114 | 875 | 100 | Minus |
nc_6806.a | 798 | nc_6806.a | 1..95 | 383..289 | 475 | 100 | Minus |
nc_6806.a | 798 | nc_6806.a | 646..709 | 114..51 | 320 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 10402107..10402295 | 289..477 | 945 | 100 | Plus |
chr2R | 21145070 | chr2R | 10401585..10401759 | 114..288 | 875 | 100 | Plus |
chr2R | 21145070 | chr2R | 10401455..10401518 | 51..114 | 320 | 100 | Plus |
chr2R | 21145070 | chr2R | 10401340..10401387 | 4..51 | 240 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 14514804..14514995 | 289..480 | 960 | 100 | Plus |
2R | 25286936 | 2R | 14514282..14514456 | 114..288 | 875 | 100 | Plus |
2R | 25286936 | 2R | 14514152..14514215 | 51..114 | 320 | 100 | Plus |
2R | 25286936 | 2R | 14514037..14514084 | 4..51 | 240 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 14516003..14516194 | 289..480 | 960 | 100 | Plus |
2R | 25260384 | 2R | 14515481..14515655 | 114..288 | 875 | 100 | Plus |
2R | 25260384 | 2R | 14515351..14515414 | 51..114 | 320 | 100 | Plus |
2R | 25260384 | 2R | 14515236..14515283 | 4..51 | 240 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 10401337..10401387 | 1..51 | 98 | -> | Plus |
chr2R | 10401456..10401518 | 52..114 | 100 | -> | Plus |
chr2R | 10401586..10401759 | 115..288 | 100 | -> | Plus |
chr2R | 10402107..10402295 | 289..477 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30197-RA | 1..342 | 48..389 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30197-RA | 1..342 | 48..389 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30197-RA | 1..342 | 48..389 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30197-RA | 1..342 | 48..389 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30197-RA | 1..342 | 48..389 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30197-RA | 1..477 | 1..477 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30197-RA | 1..477 | 1..477 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30197-RA | 1..477 | 1..477 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30197-RA | 1..477 | 1..477 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30197-RA | 5..481 | 1..477 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14514034..14514084 | 1..51 | 98 | -> | Plus |
2R | 14514153..14514215 | 52..114 | 100 | -> | Plus |
2R | 14514283..14514456 | 115..288 | 100 | -> | Plus |
2R | 14514804..14514992 | 289..477 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14514034..14514084 | 1..51 | 98 | -> | Plus |
2R | 14514153..14514215 | 52..114 | 100 | -> | Plus |
2R | 14514283..14514456 | 115..288 | 100 | -> | Plus |
2R | 14514804..14514992 | 289..477 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14514034..14514084 | 1..51 | 98 | -> | Plus |
2R | 14514153..14514215 | 52..114 | 100 | -> | Plus |
2R | 14514283..14514456 | 115..288 | 100 | -> | Plus |
2R | 14514804..14514992 | 289..477 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 10401539..10401589 | 1..51 | 98 | -> | Plus |
arm_2R | 10401658..10401720 | 52..114 | 100 | -> | Plus |
arm_2R | 10401788..10401961 | 115..288 | 100 | -> | Plus |
arm_2R | 10402309..10402497 | 289..477 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14515233..14515283 | 1..51 | 98 | -> | Plus |
2R | 14515352..14515414 | 52..114 | 100 | -> | Plus |
2R | 14515482..14515655 | 115..288 | 100 | -> | Plus |
2R | 14516003..14516191 | 289..477 | 100 | Plus |
Translation from 47 to 388
> RE05231.pep MVKLGFLSLLIAACVVAAFAAGDCPSSTKVQNCTPKCLHDSECSAIGGKC CPNLCNGRSCAQPNVLGNSGADKSPFGSKNSGATGSYCGNVKCGSFEKCE MDRSTKRPKCVRS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13511-PA | 111 | GF13511-PA | 1..111 | 3..113 | 398 | 89.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20463-PA | 113 | GG20463-PA | 1..113 | 1..113 | 573 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20786-PA | 110 | GH20786-PA | 3..110 | 6..113 | 460 | 83.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG30197-PA | 113 | CG30197-PA | 1..113 | 1..113 | 621 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20871-PA | 116 | GI20871-PA | 22..116 | 19..113 | 455 | 93.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11445-PA | 113 | GL11445-PA | 1..113 | 1..113 | 526 | 90.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15722-PA | 113 | GA15722-PA | 1..113 | 1..113 | 526 | 90.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21553-PA | 92 | GM21553-PA | 2..92 | 23..113 | 463 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11059-PA | 113 | GD11059-PA | 1..113 | 1..113 | 573 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20606-PA | 122 | GJ20606-PA | 19..122 | 10..113 | 473 | 86.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15838-PA | 166 | GK15838-PA | 52..166 | 1..113 | 483 | 80.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13595-PA | 113 | GE13595-PA | 1..113 | 1..113 | 576 | 100 | Plus |
Translation from 47 to 388
> RE05231.hyp MVKLGFLSLLIAACVVAAFAAGDCPSSTKVQNCTPKCLHDSECSAIGGKC CPNLCNGRSCAQPNVLGNSGADKSPFGSKNSGATGSYCGNVKCGSFEKCE MDRSTKRPKCVRS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG30197-PA | 113 | CG30197-PA | 1..113 | 1..113 | 621 | 100 | Plus |