Clone RE05274 Report

Search the DGRC for RE05274

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:52
Well:74
Vector:pFlc-1
Associated Gene/Transcriptsosie-RA
Protein status:RE05274.pep: gold
Preliminary Size:954
Sequenced Size:1753

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13636 2002-11-22 Blastp of sequenced clone
CG13636 2003-01-01 Sim4 clustering to Release 3
CG13636 2008-04-29 Release 5.5 accounting
CG13636 2008-08-15 Release 5.9 accounting
CG13636 2008-12-18 5.12 accounting

Clone Sequence Records

RE05274.complete Sequence

1753 bp (1753 high quality bases) assembled on 2002-11-22

GenBank Submission: BT003219

> RE05274.complete
CTTGCATTTCGAGCGCGCAGGCGACTGGTTGGAGCTACCCGTCCGAAGAC
CCCAAGTGGAAGTTGCGACTATAGCGAGTGCCCCAAAGTATTGGAGATTT
TTTGGAGTGACGCCTCTCGTGCGGTTTTGTTTTGCTTCGGACTTTCTGGC
GGAGCGGAAACGATTTCGGTGTGAAAATTTGCATAAAATTGTGCCCGCGA
AACCGACATAGAAACGAAAAAAGCGTTAAGTAAACCAATTTAAAGCCTTT
GGGCCGTTTTTCAAGCTCGCAAAGTGCGTGTGCAACCCGTTGCGGTCCTG
TGGAATTTATATAAGACCCGAAAAAGGACTTCTTTCCGACTTCTTCAAGT
CCTGGTCTCGACTCAAAACTCGATTAGTTACCGATTCCAAAATGCAGCCC
CTGAAGCGCTTCACACAATGCGGCAGTCTGACCATGCTCTTCGGCATCTT
CATCATCCTCTTCGGGGTCAGCTCCACGGCTCTGACCACTTTTGGCAAGA
CCAACAATCAGCCGCCTCCCACGCACGTCCCAATTGTTAAAGGACGAGAG
TGCAGTGCCCACGATGATTGCACGGCGATAGATCGCACCAGCTGCGTCAA
GGATCCCAATGACTACAAGCTGCGTTGCCTATGCGGCGACGACTCGCCTC
CTTCGGCTGGCAGCTGTCCAGATGTCCTGAAAGGCCTGCGTCACAAGTGC
AACAGCAACAACGACTGCGAGGATGGAATGGTGTGCCAGTACGAGAACAG
CAACCGCACCATCGGAGTGGCCAAGTTCATGTCCAGCAAGACCAAGCTGT
GTCTCTGCGACAACGACAACGGATATGTGGAGGACATCCTGCACGACATC
TGCAGTGGAGCTAATCTTCAGGGCCTGGTCAGCTTCTTGGTCTCGATCTG
CTCACTTCTGGCGCCCTTTTTGGTATCCGCCCACATGCGAAAGCATTTCT
AGAAGGCGATCGTCGAAAGCGGAACCGGAAGACGTAGTTTGGCGTTTATC
TACCCCAGTGATCCATCAAATGTGCCTCAGTGAAACCAACAGAAACAAAA
GATCATCCTACCCCTACCACTAACCCCTCACATATAAAAAAATACGAAAA
GTAAATCTTGAAAAGCGAAAAAAATAAGAGAAAATACGTGGAAATGAAAT
TAAGAAAGTTAGATACTCGTCGCCATTAGCCTAAAAGTCGTTCTATTGTA
TAAGTTTCATATGTACCACCGTCAAGTTTATTCGCTTCTCACGAAAAGTT
GCGTTATATACAATATACATAATTGTATTATCTGATAAACGTTTTCCATA
GATCCCCAATCGAACTTAGTCCGTACTCCCTACACTAGACAGACCGAAGT
AACTTTAGATCAAATGTTAGGCACCATTTTATTGTAATTTTATATGAGTG
TACGTGTGTGTCCAGGAATAATCACTAAAAATCGAGAGAAATTATCTAGT
GATAGGCAACTTTTCAGCAGCACTGTGAATTCAGATCGCTTACATCGCAA
TTACAAATGTGAAACATTTTTAATTTTTGTATGTATTCAATATAAATAGC
TTTACGAGCTCACAGCCCATAATCGAATGGAATAATAATAATAATAATAA
TAATAAAATATGGGAGACGATAAAAGTTAATAATATTTTCATGTCCAAGT
TGCAGGTCCAGATAAGAATTTCACCCATTAAAACCGTTTTCTTCGTAGCT
GTTATCTATACTATTTAATAAAAACCTTTAAAAACCCAAAAAAAAAAAAA
AAA

RE05274.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:32:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG13636-RA 1756 CG13636-RA 13..1752 1..1740 8685 99.9 Plus
CG13636-RB 1533 CG13636-RB 326..1529 537..1740 6005 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:42:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20662849..20663728 859..1737 4290 99.4 Plus
chr3R 27901430 chr3R 20659924..20660463 1..540 2685 99.8 Plus
chr3R 27901430 chr3R 20662550..20662728 682..860 895 100 Plus
chr3R 27901430 chr3R 20661289..20661437 536..684 745 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:28:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:42:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24839610..24840491 859..1740 4395 99.9 Plus
3R 32079331 3R 24836682..24837221 1..540 2685 99.8 Plus
3R 32079331 3R 24839311..24839489 682..860 895 100 Plus
3R 32079331 3R 24838050..24838198 536..684 745 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:07:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24580441..24581322 859..1740 4395 99.8 Plus
3R 31820162 3R 24577513..24578052 1..540 2685 99.8 Plus
3R 31820162 3R 24580142..24580320 682..860 895 100 Plus
3R 31820162 3R 24578881..24579029 536..684 745 100 Plus
Blast to na_te.dros performed on 2019-03-16 04:42:30 has no hits.

RE05274.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:43:13 Download gff for RE05274.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20661290..20661436 537..683 100 -> Plus
chr3R 20662552..20662728 684..860 100 -> Plus
chr3R 20659924..20660459 1..536 100 -> Plus
chr3R 20662851..20663728 861..1737 96   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:49:01 Download gff for RE05274.complete
Subject Subject Range Query Range Percent Splice Strand
CG13636-RA 1..561 392..952 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:03:10 Download gff for RE05274.complete
Subject Subject Range Query Range Percent Splice Strand
CG13636-RA 1..561 392..952 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:39:44 Download gff for RE05274.complete
Subject Subject Range Query Range Percent Splice Strand
sosie-RA 1..561 392..952 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:53:28 Download gff for RE05274.complete
Subject Subject Range Query Range Percent Splice Strand
CG13636-RA 1..561 392..952 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:48:44 Download gff for RE05274.complete
Subject Subject Range Query Range Percent Splice Strand
sosie-RA 1..561 392..952 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:21:38 Download gff for RE05274.complete
Subject Subject Range Query Range Percent Splice Strand
CG13636-RA 3..1739 1..1737 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:03:10 Download gff for RE05274.complete
Subject Subject Range Query Range Percent Splice Strand
CG13636-RA 3..1739 1..1737 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:39:44 Download gff for RE05274.complete
Subject Subject Range Query Range Percent Splice Strand
sosie-RA 2..1738 1..1737 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:53:28 Download gff for RE05274.complete
Subject Subject Range Query Range Percent Splice Strand
CG13636-RA 3..1739 1..1737 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:48:44 Download gff for RE05274.complete
Subject Subject Range Query Range Percent Splice Strand
sosie-RA 2..1738 1..1737 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:43:13 Download gff for RE05274.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24836682..24837217 1..536 100 -> Plus
3R 24838051..24838197 537..683 100 -> Plus
3R 24839313..24839489 684..860 100 -> Plus
3R 24839612..24840488 861..1737 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:43:13 Download gff for RE05274.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24836682..24837217 1..536 100 -> Plus
3R 24838051..24838197 537..683 100 -> Plus
3R 24839313..24839489 684..860 100 -> Plus
3R 24839612..24840488 861..1737 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:43:13 Download gff for RE05274.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24836682..24837217 1..536 100 -> Plus
3R 24838051..24838197 537..683 100 -> Plus
3R 24839313..24839489 684..860 100 -> Plus
3R 24839612..24840488 861..1737 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:39:44 Download gff for RE05274.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20665035..20665211 684..860 100 -> Plus
arm_3R 20662404..20662939 1..536 100 -> Plus
arm_3R 20663773..20663919 537..683 100 -> Plus
arm_3R 20665334..20666210 861..1737 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:25:37 Download gff for RE05274.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24580144..24580320 684..860 100 -> Plus
3R 24577513..24578048 1..536 100 -> Plus
3R 24578882..24579028 537..683 100 -> Plus
3R 24580443..24581319 861..1737 99   Plus

RE05274.pep Sequence

Translation from 391 to 951

> RE05274.pep
MQPLKRFTQCGSLTMLFGIFIILFGVSSTALTTFGKTNNQPPPTHVPIVK
GRECSAHDDCTAIDRTSCVKDPNDYKLRCLCGDDSPPSAGSCPDVLKGLR
HKCNSNNDCEDGMVCQYENSNRTIGVAKFMSSKTKLCLCDNDNGYVEDIL
HDICSGANLQGLVSFLVSICSLLAPFLVSAHMRKHF*

RE05274.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:06:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16994-PA 186 GF16994-PA 1..186 1..186 931 93 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:06:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11324-PA 186 GG11324-PA 1..186 1..186 984 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:07:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19596-PA 183 GH19596-PA 1..183 1..186 798 80.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:36
Subject Length Description Subject Range Query Range Score Percent Strand
sosie-PA 186 CG13636-PA 1..186 1..186 1014 100 Plus
sosie-PC 74 CG13636-PC 1..74 113..186 391 100 Plus
sosie-PB 74 CG13636-PB 1..74 113..186 391 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:07:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23989-PA 188 GI23989-PA 1..188 1..186 836 81.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:07:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13789-PA 186 GL13789-PA 1..186 1..186 935 93 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:07:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26795-PA 186 GA26795-PA 1..186 1..186 935 93 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17767-PA 186 GM17767-PA 1..186 1..186 984 100 Plus
Dsec\GM26632-PA 74 GM26632-PA 1..74 113..186 373 95.9 Plus
Dsec\GM26631-PA 80 GM26631-PA 1..80 1..109 280 56.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21135-PA 186 GD21135-PA 1..186 1..186 984 100 Plus
Dsim\GD15183-PA 92 GD15183-PA 4..92 98..186 471 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:07:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23625-PA 188 GJ23625-PA 1..188 1..186 855 85.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:07:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22487-PA 187 GK22487-PA 1..187 1..186 917 91.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:07:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23520-PA 186 GE23520-PA 1..186 1..186 980 99.5 Plus

RE05274.hyp Sequence

Translation from 391 to 951

> RE05274.hyp
MQPLKRFTQCGSLTMLFGIFIILFGVSSTALTTFGKTNNQPPPTHVPIVK
GRECSAHDDCTAIDRTSCVKDPNDYKLRCLCGDDSPPSAGSCPDVLKGLR
HKCNSNNDCEDGMVCQYENSNRTIGVAKFMSSKTKLCLCDNDNGYVEDIL
HDICSGANLQGLVSFLVSICSLLAPFLVSAHMRKHF*

RE05274.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:27:04
Subject Length Description Subject Range Query Range Score Percent Strand
sosie-PA 186 CG13636-PA 1..186 1..186 1014 100 Plus
sosie-PC 74 CG13636-PC 1..74 113..186 391 100 Plus
sosie-PB 74 CG13636-PB 1..74 113..186 391 100 Plus