Clone RE05342 Report

Search the DGRC for RE05342

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:53
Well:42
Vector:pFlc-1
Associated Gene/Transcriptlin-28-RA
Protein status:RE05342.pep: gold
Preliminary Size:546
Sequenced Size:1165

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17334 2002-01-01 Sim4 clustering to Release 2
CG17334 2003-01-01 Sim4 clustering to Release 3
CG17334 2003-08-05 Blastp of sequenced clone
lin-28 2008-04-29 Release 5.5 accounting
lin-28 2008-08-15 Release 5.9 accounting
lin-28 2008-12-18 5.12 accounting

Clone Sequence Records

RE05342.complete Sequence

1165 bp (1165 high quality bases) assembled on 2003-08-05

GenBank Submission: AY118360

> RE05342.complete
AAACGCAACGCGGAGTCAGTGTGACGAAGTGCGTCGTGCGCAGCGGCAGC
GTTTTCCTAATTTCCCCTTCGCTGAACCCAAAAATTCGAGAAAGTGCTGT
AGCTGTGTTAGTGCGGGCAGTGAAAGATACAGATACAAATACAGATACGG
ATCTTTGGCCACATGTCTGTTCGTTGGCAGGAAAAACATGCATTTGCAGT
GAAGTTTTAAGCAACATTGAATTTTGGAGCGAGTAATCAAACAATTGAAG
TGGATTTTAAACTAAGAAAAATAAACTAAAAACCCAAGAAGTCAGCATGG
AGAACGTACAGCTGGAAAATGGCTTGGAAAGGAGGACCACCAGCCAGAGT
TCCACTTCATCAGCGAATCCGGCAAATCTTGCGAGTCCCACCGAGGAATG
CGGTTGTGTGCGACTGGGCAAATGCAAATGGTTCAACGTGGCCAAGGGAT
GGGGCTTCCTTACACCCAACGACGGCGGCCAGGAGGTGTTCGTCCATCAG
AGCGTCATCCAGATGTCAGGTTTCCGATCACTGGGCGAGCAGGAGGAGGT
GGAATTCGAGTGCCAGCGCACGTCGCGCGGATTGGAGGCCACCAGGGTGT
CCAGCAGGCATGGCGGTAGCTGCCAAGGCAGCACCTACAGGCCGCGAATA
AATCGCCGGACTCGCCGCATGCGCTGCTACAACTGCGGCGAATTCGCCAA
TCACATTGCCTCCGAATGCGCTTTGGGTCCTCAGCCGAAGCGCTGTCATC
GCTGCCGTGGAGAAGACCATCTCCATGCCGACTGCCCGCACAAGAATGTG
ACCCAAAGCCACAGTAATAGCAAAAGCATAAGCAACAATAGCAGCAGCAG
TGCAGCCCAAGAGAAGAGCGAGGAGGCCACCTAGGAAGTCCTTGGATCTT
GGACTGGTAGTTGGAAGTTAGAAACTTCCTTGACAAGTACAAAATGGAAA
TCTAAGAAAAAACACGCATCAAATCAAAGAAACCCACGTACAACAAAACT
AGCTACTACACTTAGATATTAGCGGGAAGAGACGCGCCCCGAAAACCATC
CTATCCTAAGTTTATTTTCTATTTTAACATTATTTTCTAGGAACCATAGT
TGCTAAGGTTTTTCACTAGATCCCAAGTAAACGAATTAAGCTAGAGAGCA
AAAAAAAAAAAAAAA

RE05342.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:51:54
Subject Length Description Subject Range Query Range Score Percent Strand
lin-28-RA 1436 lin-28-RA 150..1299 1..1150 5750 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:25:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 5649599..5649947 800..1149 1655 98.9 Plus
chr3L 24539361 chr3L 5647244..5647611 1..363 1640 97 Plus
chr3L 24539361 chr3L 5649167..5649317 499..649 755 100 Plus
chr3L 24539361 chr3L 5649387..5649537 650..800 755 100 Plus
chr3L 24539361 chr3L 5648880..5649019 361..500 700 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:28:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:25:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5654684..5655046 1..363 1815 100 Plus
3L 28110227 3L 5657035..5657385 800..1150 1755 100 Plus
3L 28110227 3L 5656603..5656753 499..649 755 100 Plus
3L 28110227 3L 5656823..5656973 650..800 755 100 Plus
3L 28110227 3L 5656316..5656455 361..500 700 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:17:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 5647784..5648146 1..363 1815 100 Plus
3L 28103327 3L 5650135..5650485 800..1150 1755 100 Plus
3L 28103327 3L 5649923..5650073 650..800 755 100 Plus
3L 28103327 3L 5649703..5649853 499..649 755 100 Plus
3L 28103327 3L 5649416..5649555 361..500 700 100 Plus
Blast to na_te.dros performed 2019-03-16 22:25:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6793..6856 790..850 124 68.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2314..2364 807..856 117 72.5 Plus
roo 9092 roo DM_ROO 9092bp 1058..1100 815..856 113 76.7 Plus

RE05342.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:26:47 Download gff for RE05342.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 5647244..5647611 1..363 97 -> Plus
chr3L 5648883..5649019 364..500 100 -> Plus
chr3L 5649169..5649317 501..649 100 -> Plus
chr3L 5649387..5649537 650..800 100 -> Plus
chr3L 5649600..5649947 801..1149 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:49:05 Download gff for RE05342.complete
Subject Subject Range Query Range Percent Splice Strand
lin-28-RA 1..588 297..884 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:21:41 Download gff for RE05342.complete
Subject Subject Range Query Range Percent Splice Strand
lin-28-RA 1..588 297..884 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:10:39 Download gff for RE05342.complete
Subject Subject Range Query Range Percent Splice Strand
lin-28-RA 1..588 297..884 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:48:03 Download gff for RE05342.complete
Subject Subject Range Query Range Percent Splice Strand
lin-28-RA 1..588 297..884 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:38:47 Download gff for RE05342.complete
Subject Subject Range Query Range Percent Splice Strand
lin-28-RA 1..588 297..884 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:56:06 Download gff for RE05342.complete
Subject Subject Range Query Range Percent Splice Strand
lin-28-RA 2..1150 1..1149 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:21:41 Download gff for RE05342.complete
Subject Subject Range Query Range Percent Splice Strand
lin-28-RA 2..1150 1..1149 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:10:39 Download gff for RE05342.complete
Subject Subject Range Query Range Percent Splice Strand
lin-28-RA 4..1152 1..1149 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:48:03 Download gff for RE05342.complete
Subject Subject Range Query Range Percent Splice Strand
lin-28-RA 2..1150 1..1149 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:38:47 Download gff for RE05342.complete
Subject Subject Range Query Range Percent Splice Strand
lin-28-RA 4..1152 1..1149 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:26:47 Download gff for RE05342.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5656823..5656973 650..800 100 -> Plus
3L 5657036..5657384 801..1149 100   Plus
3L 5654684..5655046 1..363 100 -> Plus
3L 5656319..5656455 364..500 100 -> Plus
3L 5656605..5656753 501..649 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:26:47 Download gff for RE05342.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5656823..5656973 650..800 100 -> Plus
3L 5657036..5657384 801..1149 100   Plus
3L 5654684..5655046 1..363 100 -> Plus
3L 5656319..5656455 364..500 100 -> Plus
3L 5656605..5656753 501..649 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:26:47 Download gff for RE05342.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5656823..5656973 650..800 100 -> Plus
3L 5657036..5657384 801..1149 100   Plus
3L 5654684..5655046 1..363 100 -> Plus
3L 5656319..5656455 364..500 100 -> Plus
3L 5656605..5656753 501..649 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:10:39 Download gff for RE05342.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5647784..5648146 1..363 100 -> Plus
arm_3L 5649419..5649555 364..500 100 -> Plus
arm_3L 5649705..5649853 501..649 100 -> Plus
arm_3L 5649923..5650073 650..800 100 -> Plus
arm_3L 5650136..5650484 801..1149 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:24:30 Download gff for RE05342.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5647784..5648146 1..363 100 -> Plus
3L 5649419..5649555 364..500 100 -> Plus
3L 5649705..5649853 501..649 100 -> Plus
3L 5649923..5650073 650..800 100 -> Plus
3L 5650136..5650484 801..1149 100   Plus

RE05342.pep Sequence

Translation from 296 to 883

> RE05342.pep
MENVQLENGLERRTTSQSSTSSANPANLASPTEECGCVRLGKCKWFNVAK
GWGFLTPNDGGQEVFVHQSVIQMSGFRSLGEQEEVEFECQRTSRGLEATR
VSSRHGGSCQGSTYRPRINRRTRRMRCYNCGEFANHIASECALGPQPKRC
HRCRGEDHLHADCPHKNVTQSHSNSKSISNNSSSSAAQEKSEEAT*

RE05342.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:35:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10852-PA 347 GF10852-PA 50..140 29..114 158 38.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:35:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16919-PA 345 GH16919-PA 36..155 28..134 165 34.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
lin-28-PA 195 CG17334-PA 1..195 1..195 1052 100 Plus
yps-PB 340 CG5654-PB 51..150 29..123 152 38 Plus
yps-PA 352 CG5654-PA 51..150 29..123 152 38 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:35:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13673-PA 335 GI13673-PA 35..125 29..114 154 38.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:35:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15684-PA 335 GL15684-PA 38..146 29..124 164 36.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:35:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14466-PA 192 GA14466-PA 1..185 1..180 666 78 Plus
Dpse\GA23502-PA 335 GA23502-PA 38..146 29..124 164 36.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:35:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24682-PA 1378 GM24682-PA 51..159 29..124 152 35.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:35:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12750-PA 352 GD12750-PA 51..141 29..114 160 39.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:35:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14010-PA 340 GJ14010-PA 35..125 29..114 155 38.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:35:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16710-PA 344 GK16710-PA 36..126 29..114 157 38.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:35:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20150-PA 353 GE20150-PA 52..142 29..114 160 39.6 Plus

RE05342.hyp Sequence

Translation from 296 to 883

> RE05342.hyp
MENVQLENGLERRTTSQSSTSSANPANLASPTEECGCVRLGKCKWFNVAK
GWGFLTPNDGGQEVFVHQSVIQMSGFRSLGEQEEVEFECQRTSRGLEATR
VSSRHGGSCQGSTYRPRINRRTRRMRCYNCGEFANHIASECALGPQPKRC
HRCRGEDHLHADCPHKNVTQSHSNSKSISNNSSSSAAQEKSEEAT*

RE05342.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:08:41
Subject Length Description Subject Range Query Range Score Percent Strand
lin-28-PA 195 CG17334-PA 1..195 1..195 1052 100 Plus
yps-PB 340 CG5654-PB 51..150 29..123 152 38 Plus
yps-PA 352 CG5654-PA 51..150 29..123 152 38 Plus