Clone RE05521 Report

Search the DGRC for RE05521

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:55
Well:21
Vector:pFlc-1
Associated Gene/TranscriptCG5804-RA
Protein status:RE05521.pep: gold
Preliminary Size:249
Sequenced Size:350

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5804 2001-12-14 Blastp of sequenced clone
CG5804 2002-01-01 Sim4 clustering to Release 2
CG5804 2008-04-29 Release 5.5 accounting
CG5804 2008-08-15 Release 5.9 accounting
CG5804 2008-12-18 5.12 accounting

Clone Sequence Records

RE05521.complete Sequence

350 bp (350 high quality bases) assembled on 2001-12-14

GenBank Submission: AY070953

> RE05521.complete
GACTTTTGTCAAGCATAACTCAAGCAATATGGCCGATTTCAACGCTATCC
TCGAGAAGACCAAGGCCTTCAGCAAGAAGCCCCCAACGGAGGTGTACCTG
GAGTTCTATGGCCTGTACAAGCAGTTCCAGGAGGGCGACATTAACATCGA
GAAGCCCGCTGATGCCGAGGGTGCCGCTAAGTACGATGCCTGGCTGAGCC
GCAAGGGACTGTCCGTCGATGACGCCAAGGCCGCCTACGTCGCCCTGTAC
GAGAAGTACAACCCCATCTACGGATAAGCTACAGTTTATGGCCCACTCTG
ATACCAACCAATAAATCTTGACCATCTGTGAACTAAAAAAAAAAAAAAAA

RE05521.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG5804-RA 648 CG5804-RA 137..468 5..336 1660 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:42:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8780085..8780381 334..38 1440 99 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:28:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:42:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8788142..8788440 336..38 1495 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8781242..8781540 336..38 1495 100 Minus
3L 28103327 3L 8781606..8781638 37..5 165 100 Minus
Blast to na_te.dros performed on 2019-03-16 15:42:55 has no hits.

RE05521.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:43:35 Download gff for RE05521.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8780085..8780381 38..334 98 <- Minus
chr3L 8780447..8780482 1..37 91   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:49:17 Download gff for RE05521.complete
Subject Subject Range Query Range Percent Splice Strand
CG5804-RA 1..249 29..277 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:37 Download gff for RE05521.complete
Subject Subject Range Query Range Percent Splice Strand
CG5804-RA 1..249 29..277 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:52:08 Download gff for RE05521.complete
Subject Subject Range Query Range Percent Splice Strand
CG5804-RA 1..249 29..277 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:09 Download gff for RE05521.complete
Subject Subject Range Query Range Percent Splice Strand
CG5804-RA 1..249 29..277 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:52:29 Download gff for RE05521.complete
Subject Subject Range Query Range Percent Splice Strand
CG5804-RA 1..249 29..277 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:09:04 Download gff for RE05521.complete
Subject Subject Range Query Range Percent Splice Strand
CG5804-RA 1..332 3..334 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:37 Download gff for RE05521.complete
Subject Subject Range Query Range Percent Splice Strand
CG5804-RA 1..332 3..334 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:52:08 Download gff for RE05521.complete
Subject Subject Range Query Range Percent Splice Strand
CG5804-RA 4..337 1..334 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:09 Download gff for RE05521.complete
Subject Subject Range Query Range Percent Splice Strand
CG5804-RA 1..332 3..334 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:52:29 Download gff for RE05521.complete
Subject Subject Range Query Range Percent Splice Strand
CG5804-RA 4..337 1..334 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:43:35 Download gff for RE05521.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8788144..8788440 38..334 100 <- Minus
3L 8788506..8788541 1..37 94   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:43:35 Download gff for RE05521.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8788144..8788440 38..334 100 <- Minus
3L 8788506..8788541 1..37 94   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:43:35 Download gff for RE05521.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8788144..8788440 38..334 100 <- Minus
3L 8788506..8788541 1..37 94   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:52:08 Download gff for RE05521.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8781244..8781540 38..334 100 <- Minus
arm_3L 8781606..8781641 1..37 94   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:21:08 Download gff for RE05521.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8781244..8781540 38..334 100 <- Minus
3L 8781606..8781641 1..37 94   Minus

RE05521.hyp Sequence

Translation from 0 to 276

> RE05521.hyp
TFVKHNSSNMADFNAILEKTKAFSKKPPTEVYLEFYGLYKQFQEGDINIE
KPADAEGAAKYDAWLSRKGLSVDDAKAAYVALYEKYNPIYG*

RE05521.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:57:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG5804-PA 82 CG5804-PA 1..82 10..91 430 100 Plus
CG15829-PB 82 CG15829-PB 1..81 10..90 225 53.1 Plus
CG15829-PA 82 CG15829-PA 1..81 10..90 225 53.1 Plus
CG8629-PA 84 CG8629-PA 1..83 10..90 211 53 Plus
CG8628-PA 84 CG8628-PA 1..83 10..90 205 51.8 Plus

RE05521.pep Sequence

Translation from 28 to 276

> RE05521.pep
MADFNAILEKTKAFSKKPPTEVYLEFYGLYKQFQEGDINIEKPADAEGAA
KYDAWLSRKGLSVDDAKAAYVALYEKYNPIYG*

RE05521.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:24:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10147-PA 82 GF10147-PA 1..82 1..82 395 93.9 Plus
Dana\GF25009-PA 82 GF25009-PA 1..81 1..81 215 53.1 Plus
Dana\GF25010-PA 84 GF25010-PA 1..84 1..82 208 53.6 Plus
Dana\GF24791-PA 84 GF24791-PA 1..84 1..82 195 52.4 Plus
Dana\GF14408-PA 88 GF14408-PA 4..75 3..72 153 47.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:24:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15060-PA 82 GG15060-PA 1..82 1..82 408 96.3 Plus
Dere\GG14404-PA 82 GG14404-PA 1..81 1..81 205 51.9 Plus
Dere\GG14997-PA 84 GG14997-PA 1..84 1..82 193 52.4 Plus
Dere\GG14405-PA 84 GG14405-PA 1..84 1..82 188 51.2 Plus
Dere\GG23473-PA 90 GG23473-PA 4..77 1..72 144 41.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:24:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16139-PA 81 GH16139-PA 2..80 3..81 330 77.2 Plus
Dgri\GH13894-PA 81 GH13894-PA 2..80 3..81 330 77.2 Plus
Dgri\GH16140-PA 84 GH16140-PA 1..84 1..82 208 52.4 Plus
Dgri\GH14516-PA 82 GH14516-PA 1..81 1..81 206 51.9 Plus
Dgri\GH17042-PA 84 GH17042-PA 1..84 1..82 202 53.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:23
Subject Length Description Subject Range Query Range Score Percent Strand
Acbp5-PA 82 CG5804-PA 1..82 1..82 430 100 Plus
Acbp6-PB 82 CG15829-PB 1..81 1..81 225 53.1 Plus
Acbp6-PA 82 CG15829-PA 1..81 1..81 225 53.1 Plus
Acbp4-PA 84 CG8629-PA 1..83 1..81 211 53 Plus
Acbp3-PA 84 CG8628-PA 1..83 1..81 205 51.8 Plus
Acbp3-PB 84 CG8628-PB 1..83 1..81 205 51.8 Plus
Acbp1-PB 90 CG8498-PB 4..76 1..71 150 43.8 Plus
Acbp1-PA 90 CG8498-PA 4..76 1..71 150 43.8 Plus
Acbp2-PA 86 CG8627-PA 6..79 4..75 144 39.2 Plus
Acbp2-PB 86 CG8627-PB 6..79 4..75 144 39.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:24:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13294-PA 82 GI13294-PA 1..81 1..81 174 46.9 Plus
Dmoj\GI13295-PA 87 GI13295-PA 6..80 3..75 147 42.7 Plus
Dmoj\GI17002-PA 90 GI17002-PA 4..77 1..72 144 43.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:24:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10280-PA 81 GL10280-PA 2..81 3..82 380 93.8 Plus
Dper\GL25026-PA 82 GL25026-PA 1..77 1..77 200 53.8 Plus
Dper\GL25027-PA 84 GL25027-PA 1..84 1..82 194 52.4 Plus
Dper\GL25142-PA 84 GL25142-PA 1..84 1..82 192 50 Plus
Dper\GL25029-PA 87 GL25029-PA 7..80 4..75 145 43.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:24:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19142-PA 81 GA19142-PA 2..81 3..82 380 93.8 Plus
Dpse\GA13977-PA 82 GA13977-PA 1..77 1..77 200 53.8 Plus
Dpse\GA23591-PA 84 GA23591-PA 1..84 1..82 194 52.4 Plus
Dpse\GA21220-PA 84 GA21220-PA 1..84 1..82 192 50 Plus
Dpse\GA21218-PA 87 GA21218-PA 7..80 4..75 145 43.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:24:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24916-PA 81 GM24916-PA 5..81 6..82 385 98.7 Plus
Dsec\GM14820-PA 82 GM14820-PA 1..81 1..81 209 51.9 Plus
Dsec\GM13788-PA 84 GM13788-PA 1..84 1..82 195 52.4 Plus
Dsec\GM14821-PA 84 GM14821-PA 1..84 1..82 195 52.4 Plus
Dsec\GM13159-PA 90 GM13159-PA 4..77 1..72 146 41.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:24:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12963-PA 82 GD12963-PA 1..82 1..82 418 100 Plus
Dsim\GD13993-PA 82 GD13993-PA 1..81 1..81 209 51.9 Plus
Dsim\GD13089-PA 84 GD13089-PA 1..84 1..82 195 52.4 Plus
Dsim\GD13994-PA 84 GD13994-PA 1..84 1..82 195 52.4 Plus
Dsim\GD22437-PA 90 GD22437-PA 4..77 1..72 146 41.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:24:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12298-PA 81 GJ12298-PA 2..80 3..81 336 79.7 Plus
Dvir\GJ13316-PA 84 GJ13316-PA 1..84 1..82 203 53.6 Plus
Dvir\GJ12299-PA 83 GJ12299-PA 2..83 3..82 198 53.7 Plus
Dvir\GJ12060-PA 82 GJ12060-PA 1..81 1..81 197 49.4 Plus
Dvir\GJ12061-PA 87 GJ12061-PA 6..78 3..73 142 42.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:24:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19285-PA 79 GK19285-PA 1..79 4..82 333 79.7 Plus
Dwil\GK19286-PA 81 GK19286-PA 1..80 4..81 201 53.8 Plus
Dwil\GK17538-PA 84 GK17538-PA 1..84 1..82 195 51.2 Plus
Dwil\GK16652-PA 82 GK16652-PA 1..81 1..81 194 48.1 Plus
Dwil\GK23743-PA 90 GK23743-PA 4..77 1..72 160 47.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:24:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21283-PA 82 GE21283-PA 1..82 1..82 411 97.6 Plus
Dyak\GE21594-PA 82 GE21594-PA 1..81 1..81 208 51.9 Plus
Dyak\GE20443-PA 84 GE20443-PA 1..84 1..82 196 52.4 Plus
Dyak\GE21595-PA 84 GE21595-PA 1..84 1..82 194 52.4 Plus
Dyak\GE11169-PA 90 GE11169-PA 4..76 1..71 149 45.2 Plus