Clone RE05963 Report

Search the DGRC for RE05963

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:59
Well:63
Vector:pFlc-1
Associated Gene/TranscriptCpr97Eb-RA
Protein status:RE05963.pep: gold
Preliminary Size:714
Sequenced Size:1062

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15884 2001-12-14 Blastp of sequenced clone
CG15884 2002-01-01 Sim4 clustering to Release 2
CG15884 2003-01-01 Sim4 clustering to Release 3
Cpr97Eb 2008-04-29 Release 5.5 accounting
Cpr97Eb 2008-08-15 Release 5.9 accounting
Cpr97Eb 2008-12-18 5.12 accounting

Clone Sequence Records

RE05963.complete Sequence

1062 bp (1062 high quality bases) assembled on 2001-12-14

GenBank Submission: AY070959

> RE05963.complete
GAGTTTGTCGTTTCGATTCGCAGAGTCTCGAGTGCAAGTGCAGAACACAT
TTTCCATTTTCGCAGTGCATAACTACTTTGGGAGATTGGTGAAAACGGTT
CGACATTGACAATTGGTTCTAAGCTTGGCAGCATGTTGAAATTGACCTTG
AGCTTGGGTCTTCTGCTTCTGGCGGCCCACAGTGCGTATGCGCAACACCA
GGACTACACCACACCGGTGCCCATTCTCAAGCAGATCGACAAGCACAACG
ACGATGGTTCCTACACATATGGATACGAAGCGGCCGATAAGAGCTTCAAG
ATCGAAACCAAGTACGCGAATGGAGAGGTCTATGGAAAGTACGGTTATGT
GGATGACCAGGGAAAAGTGCGGGAAATAGAGTATGGAGCCAGTAAGCGTG
GCTTTGAGCCCGCTGGCAGTCACATCAATGTGCCACCACCTACGCTGACC
AACAGCAATCCCTATCCATTGGGACCCAACGAATTGGACGATGGCCAGTA
TCGTGAGGACCCCTCGGTGTACTACAAGGACCAGAAGTTCAATCGCCCCC
TTTCACCGGCCAGTAAATTCAGTCTGAACGATTTCGGCCGCGGCCAGCAG
CAGGCGTATGCCCCGCCACCTCGGCAGCCCGCCCCACAAACGCCCTACTA
CAATCCCACACCCCAATACTACAATCCCCCGGCTCCGCAGCCCCGTTACT
ACCAGCCTCCGGCCCAGAACTACTATAATCCCCAGCAGCAACAGCCATAC
AGGGGGTTGCCGGAGCAACATCATCCCTCCCTGCGAAATCTCAACCTCTA
CACCGGTTCCTATAGCATCGACTATACGGGCCGGAAGTAGGAAGGAGGAC
CTTTTGATGGGGGGATCACCTCTGAGTTGGGCCAGAGAGTCAGGGACTGA
AGTGTCCGAGGACAATGTCAACTTGTTACTGCCAAATAAATCAGTCACTC
CGCACACCCCACACATGTATCTATTACTGTACCTGTTTATATATGTTCTT
GAATGTGTGTAATAAATCGAGTTTTGAAACCTGAAGCGTTTACAGAGAAA
AAAAAAAAAAAA

RE05963.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:05
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr97Eb-RA 1285 Cpr97Eb-RA 196..1246 1..1051 5255 100 Plus
Cpr97Eb.b 1611 Cpr97Eb.b 522..1572 1..1051 5255 100 Plus
Cpr97Eb.a 981 Cpr97Eb.a 68..976 143..1051 4545 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:52:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22912731..22913634 1047..144 4430 99.3 Minus
chr3R 27901430 chr3R 22914007..22914150 144..1 690 98.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:28:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:52:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27089700..27090607 1051..144 4540 100 Minus
3R 32079331 3R 27090980..27091123 144..1 720 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26830531..26831438 1051..144 4540 100 Minus
3R 31820162 3R 26831811..26831954 144..1 720 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:52:35 has no hits.

RE05963.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:54:25 Download gff for RE05963.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22914007..22914150 1..144 98   Minus
chr3R 22912731..22913633 145..1047 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:49:30 Download gff for RE05963.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr97Eb-RA 1..708 133..840 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:34 Download gff for RE05963.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr97Eb-RA 1..708 133..840 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:44:38 Download gff for RE05963.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr97Eb-RA 1..708 133..840 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:07 Download gff for RE05963.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr97Eb-RA 1..708 133..840 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:19:48 Download gff for RE05963.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr97Eb-RA 1..708 133..840 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:09:00 Download gff for RE05963.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr97Eb-RA 1..1047 1..1047 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:34 Download gff for RE05963.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr97Eb-RA 1..1047 1..1047 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:44:38 Download gff for RE05963.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr97Eb-RA 8..1054 1..1047 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:07 Download gff for RE05963.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr97Eb-RA 1..1047 1..1047 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:19:48 Download gff for RE05963.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr97Eb-RA 8..1054 1..1047 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:54:25 Download gff for RE05963.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27089704..27090606 145..1047 100 <- Minus
3R 27090980..27091123 1..144 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:54:25 Download gff for RE05963.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27089704..27090606 145..1047 100 <- Minus
3R 27090980..27091123 1..144 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:54:25 Download gff for RE05963.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27089704..27090606 145..1047 100 <- Minus
3R 27090980..27091123 1..144 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:44:38 Download gff for RE05963.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22915426..22916328 145..1047 100 <- Minus
arm_3R 22916702..22916845 1..144 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:21:05 Download gff for RE05963.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26831811..26831954 1..144 100   Minus
3R 26830535..26831437 145..1047 100 <- Minus

RE05963.pep Sequence

Translation from 132 to 839

> RE05963.pep
MLKLTLSLGLLLLAAHSAYAQHQDYTTPVPILKQIDKHNDDGSYTYGYEA
ADKSFKIETKYANGEVYGKYGYVDDQGKVREIEYGASKRGFEPAGSHINV
PPPTLTNSNPYPLGPNELDDGQYREDPSVYYKDQKFNRPLSPASKFSLND
FGRGQQQAYAPPPRQPAPQTPYYNPTPQYYNPPAPQPRYYQPPAQNYYNP
QQQQPYRGLPEQHHPSLRNLNLYTGSYSIDYTGRK*

RE05963.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:24:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22954-PA 237 GF22954-PA 19..237 19..235 929 87.8 Plus
Dana\GF22955-PA 361 GF22955-PA 38..135 11..109 326 66.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:24:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12142-PA 235 GG12142-PA 1..235 1..235 1185 97.9 Plus
Dere\GG12144-PA 366 GG12144-PA 3..137 1..109 307 48.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:24:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18952-PA 236 GH18952-PA 1..236 1..235 875 82.7 Plus
Dgri\GH18953-PA 358 GH18953-PA 50..132 27..109 316 71.1 Plus
Dgri\GH19947-PA 265 GH19947-PA 1..110 1..98 145 30.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:15
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr97Eb-PA 235 CG15884-PA 1..235 1..235 1297 100 Plus
Cpr97Ea-PB 363 CG6131-PB 35..212 11..214 352 43.9 Plus
Cpr97Ea-PA 366 CG6131-PA 38..215 11..214 352 43.9 Plus
Cpr100A-PA 241 CG12045-PA 10..221 12..210 227 33.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:24:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23278-PA 223 GI23278-PA 2..223 18..235 815 79.8 Plus
Dmoj\GI23279-PA 349 GI23279-PA 34..129 14..109 331 66.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:24:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23617-PA 231 GL23617-PA 1..231 1..235 911 79.6 Plus
Dper\GL23618-PA 366 GL23618-PA 3..151 1..142 321 45.7 Plus
Dper\GL16750-PA 106 GL16750-PA 1..94 5..98 136 34 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:24:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14004-PA 231 GA14004-PA 1..231 1..235 911 79.6 Plus
Dpse\GA26662-PA 231 GA26662-PA 1..231 1..235 911 79.6 Plus
Dpse\GA23225-PA 366 GA23225-PA 51..133 27..109 318 72.3 Plus
Dpse\GA21522-PA 106 GA21522-PA 1..94 5..98 136 33 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:24:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10136-PA 235 GM10136-PA 1..235 1..235 1203 99.6 Plus
Dsec\GM10137-PA 366 GM10137-PA 56..137 28..109 298 69.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:24:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18097-PA 235 GD18097-PA 1..235 1..235 1203 99.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:24:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24136-PA 246 GJ24136-PA 22..246 15..235 821 82.7 Plus
Dvir\GJ24137-PA 356 GJ24137-PA 40..149 18..142 327 56.8 Plus
Dvir\GJ15073-PA 196 GJ15073-PA 1..110 1..98 145 33.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:24:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12037-PA 239 GK12037-PA 1..239 1..235 910 81.2 Plus
Dwil\GK12038-PA 359 GK12038-PA 36..136 11..109 329 64.4 Plus
Dwil\GK14160-PA 235 GK14160-PA 5..200 4..202 146 33.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:24:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10590-PA 235 GE10590-PA 1..235 1..235 1193 98.3 Plus
Dyak\GE10591-PA 368 GE10591-PA 56..137 28..109 306 70.7 Plus

RE05963.hyp Sequence

Translation from 132 to 839

> RE05963.hyp
MLKLTLSLGLLLLAAHSAYAQHQDYTTPVPILKQIDKHNDDGSYTYGYEA
ADKSFKIETKYANGEVYGKYGYVDDQGKVREIEYGASKRGFEPAGSHINV
PPPTLTNSNPYPLGPNELDDGQYREDPSVYYKDQKFNRPLSPASKFSLND
FGRGQQQAYAPPPRQPAPQTPYYNPTPQYYNPPAPQPRYYQPPAQNYYNP
QQQQPYRGLPEQHHPSLRNLNLYTGSYSIDYTGRK*

RE05963.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:39:29
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr97Eb-PA 235 CG15884-PA 1..235 1..235 1297 100 Plus
Cpr97Ea-PB 363 CG6131-PB 35..212 11..214 352 43.9 Plus
Cpr97Ea-PA 366 CG6131-PA 38..215 11..214 352 43.9 Plus
Cpr100A-PA 241 CG12045-PA 10..221 12..210 227 33.6 Plus