Clone RE06042 Report

Search the DGRC for RE06042

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:60
Well:42
Vector:pFlc-1
Associated Gene/TranscriptRpL10Ab-RA
Protein status:RE06042.pep: gold
Sequenced Size:775

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7283 2004-05-03 Blastp of sequenced clone
RpL10Ab 2008-04-29 Release 5.5 accounting
RpL10Ab 2008-08-15 Release 5.9 accounting
RpL10Ab 2008-12-18 5.12 accounting

Clone Sequence Records

RE06042.complete Sequence

775 bp (775 high quality bases) assembled on 2004-05-03

GenBank Submission: BT014654

> RE06042.complete
ACTTCCTTTCTAAATCGCACGTTGAACAGAAAAGATGGCGTCGAAGGTTT
CGCGTGATACGCTGTATGAGGGCGTCAATGGACTCCTGGAGGCTTCGGCG
AAGAAGAAGCGCGGCTTCCTCGAGACGGTGGAACTGCAGATCGGCCTGAA
GAACTACGATCCCCAGAAGGACAAGCGTTTCTCCGGCACCGTCAAGTTGA
AGCACATTCCTCGTCCCAAGATGAAGGTGTGCATCCTTGGCGATCAGCAG
CATTGCGACGAAGCCAAGGCCAACAACGTCGACTTCATGGATGCCGAGGC
TCTGAAGAAGCTGAACAAGAACAAGAAGCTGGTGAAGAAGCTGGCCAAGT
CCTATGATGCCTTCCTGGCCTCTGAGTCGCTGATCAAGCAGATTCCTCGT
TTGCTTGGCCCTGGCTTGAACAAGGCCGGCAAGTTCCCTGCCCTGCTGTC
GCATCAGGAGTCTATGATTGGCAAGATCGAGGAGGTTAAGTCGACCATCA
AGTTCCAGATGAAGAAGGTGCTCTGCCTGTCCGTCGCCGTCGGCCACGTT
GGCATGAAGTCCGACGAGCTGGCCCAAAACGTCAACTTGTCGATCAACTT
CTTGGTGTCGCTGTTGAAGAAGAACTGGCAGAATGTGCGCTCCCTGCACG
TCAAGTCCTCCATGGGACCGCCCCAGCGTCTTTACTAGATGCGCATACTT
CATTTTTCTTACATCTTGAAATAAATAAGATCCTACATTTTTGTAATGTA
AAAAAAAAGAAGAAAAAAAAAAAAA

RE06042.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:01:23
Subject Length Description Subject Range Query Range Score Percent Strand
RpL10Ab-RA 949 RpL10Ab-RA 151..901 1..751 3755 100 Plus
RpL10Ab.a 861 RpL10Ab.a 146..857 40..751 3560 100 Plus
RpL10Ab-RD 1029 RpL10Ab-RD 473..1028 196..751 2780 100 Plus
RpL10Ab-RD 1029 RpL10Ab-RD 68..264 1..197 985 100 Plus
RpL10Ab.a 861 RpL10Ab.a 56..96 1..41 205 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:37:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11814511..11815066 196..751 2780 100 Plus
chr3L 24539361 chr3L 11814053..11814210 40..197 790 100 Plus
chr3L 24539361 chr3L 11813705..11813745 1..41 205 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:28:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:37:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11823658..11824213 196..751 2780 100 Plus
3L 28110227 3L 11823200..11823357 40..197 790 100 Plus
3L 28110227 3L 11822852..11822892 1..41 205 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:49:47
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11816758..11817313 196..751 2780 100 Plus
3L 28103327 3L 11816300..11816457 40..197 790 100 Plus
3L 28103327 3L 11815952..11815992 1..41 205 100 Plus
Blast to na_te.dros performed on 2019-03-16 14:37:22 has no hits.

RE06042.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:38:32 Download gff for RE06042.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11813705..11813743 1..39 100 -> Plus
chr3L 11814053..11814208 40..195 100 -> Plus
chr3L 11814511..11815071 196..756 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:36:20 Download gff for RE06042.complete
Subject Subject Range Query Range Percent Splice Strand
RpL10Ab-RA 1..654 35..688 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:27:52 Download gff for RE06042.complete
Subject Subject Range Query Range Percent Splice Strand
RpL10Ab-RA 1..654 35..688 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:20:10 Download gff for RE06042.complete
Subject Subject Range Query Range Percent Splice Strand
RpL10Ab-RA 1..654 35..688 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:33:45 Download gff for RE06042.complete
Subject Subject Range Query Range Percent Splice Strand
RpL10Ab-RA 1..654 35..688 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:43:27 Download gff for RE06042.complete
Subject Subject Range Query Range Percent Splice Strand
RpL10Ab-RA 1..749 1..749 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:36:20 Download gff for RE06042.complete
Subject Subject Range Query Range Percent Splice Strand
RpL10Ab-RA 1..749 1..749 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:27:52 Download gff for RE06042.complete
Subject Subject Range Query Range Percent Splice Strand
RpL10Ab-RA 2..750 1..749 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:20:11 Download gff for RE06042.complete
Subject Subject Range Query Range Percent Splice Strand
RpL10Ab-RA 1..749 1..749 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:33:45 Download gff for RE06042.complete
Subject Subject Range Query Range Percent Splice Strand
RpL10Ab-RA 2..750 1..749 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:32 Download gff for RE06042.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11822852..11822890 1..39 100 -> Plus
3L 11823200..11823355 40..195 100 -> Plus
3L 11823658..11824218 196..756 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:32 Download gff for RE06042.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11822852..11822890 1..39 100 -> Plus
3L 11823200..11823355 40..195 100 -> Plus
3L 11823658..11824218 196..756 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:32 Download gff for RE06042.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11822852..11822890 1..39 100 -> Plus
3L 11823200..11823355 40..195 100 -> Plus
3L 11823658..11824218 196..756 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:27:52 Download gff for RE06042.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11815952..11815990 1..39 100 -> Plus
arm_3L 11816300..11816455 40..195 100 -> Plus
arm_3L 11816758..11817318 196..756 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:57:28 Download gff for RE06042.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11816758..11817318 196..756 99   Plus
3L 11815952..11815990 1..39 100 -> Plus
3L 11816300..11816455 40..195 100 -> Plus

RE06042.pep Sequence

Translation from 34 to 687

> RE06042.pep
MASKVSRDTLYEGVNGLLEASAKKKRGFLETVELQIGLKNYDPQKDKRFS
GTVKLKHIPRPKMKVCILGDQQHCDEAKANNVDFMDAEALKKLNKNKKLV
KKLAKSYDAFLASESLIKQIPRLLGPGLNKAGKFPALLSHQESMIGKIEE
VKSTIKFQMKKVLCLSVAVGHVGMKSDELAQNVNLSINFLVSLLKKNWQN
VRSLHVKSSMGPPQRLY*

RE06042.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:16:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24510-PA 217 GF24510-PA 1..217 1..217 1120 98.6 Plus
Dana\GF17830-PA 217 GF17830-PA 1..217 1..217 697 61.6 Plus
Dana\GF23437-PA 143 GF23437-PA 1..93 63..176 291 64.3 Plus
Dana\GF21648-PA 89 GF21648-PA 1..53 63..114 153 77.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:16:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15534-PA 217 GG15534-PA 1..217 1..217 1130 99.5 Plus
Dere\GG16888-PA 216 GG16888-PA 1..216 1..217 719 65.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:16:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16724-PA 217 GH16724-PA 1..217 1..217 982 94 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:30
Subject Length Description Subject Range Query Range Score Percent Strand
RpL10Ab-PA 217 CG7283-PA 1..217 1..217 1099 100 Plus
RpL10Aa-PA 216 CG3843-PA 1..216 1..217 676 63.6 Plus
RpL10Ab-PF 57 CG7283-PF 1..54 1..54 270 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:16:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20818-PA 154 GL20818-PA 1..147 1..147 645 95.2 Plus
Dper\GL20819-PA 59 GL20819-PA 1..59 159..217 306 98.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:16:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20236-PA 217 GA20236-PA 1..217 1..217 1012 96.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:16:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25301-PA 217 GM25301-PA 1..217 1..217 1135 100 Plus
Dsec\GM24197-PA 216 GM24197-PA 1..216 1..217 686 61.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:16:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14333-PA 217 GD14333-PA 1..217 1..217 1135 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:16:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11814-PA 217 GJ11814-PA 1..217 1..217 980 93.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:16:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13682-PA 217 GK13682-PA 1..217 1..217 1099 96.3 Plus
Dwil\GK25355-PA 140 GK25355-PA 1..136 1..147 534 84.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:16:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21853-PA 217 GE21853-PA 1..217 1..217 1130 99.5 Plus
Dyak\GE24270-PA 216 GE24270-PA 1..216 1..217 692 62.7 Plus

RE06042.hyp Sequence

Translation from 34 to 687

> RE06042.hyp
MASKVSRDTLYEGVNGLLEASAKKKRGFLETVELQIGLKNYDPQKDKRFS
GTVKLKHIPRPKMKVCILGDQQHCDEAKANNVDFMDAEALKKLNKNKKLV
KKLAKSYDAFLASESLIKQIPRLLGPGLNKAGKFPALLSHQESMIGKIEE
VKSTIKFQMKKVLCLSVAVGHVGMKSDELAQNVNLSINFLVSLLKKNWQN
VRSLHVKSSMGPPQRLY*

RE06042.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
RpL10Ab-PA 217 CG7283-PA 1..217 1..217 1099 100 Plus
RpL10Aa-PA 216 CG3843-PA 1..216 1..217 676 63.6 Plus
RpL10Ab-PF 57 CG7283-PF 1..54 1..54 270 100 Plus