BDGP Sequence Production Resources |
Search the DGRC for RE06042
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 60 |
Well: | 42 |
Vector: | pFlc-1 |
Associated Gene/Transcript | RpL10Ab-RA |
Protein status: | RE06042.pep: gold |
Sequenced Size: | 775 |
Gene | Date | Evidence |
---|---|---|
CG7283 | 2004-05-03 | Blastp of sequenced clone |
RpL10Ab | 2008-04-29 | Release 5.5 accounting |
RpL10Ab | 2008-08-15 | Release 5.9 accounting |
RpL10Ab | 2008-12-18 | 5.12 accounting |
775 bp (775 high quality bases) assembled on 2004-05-03
GenBank Submission: BT014654
> RE06042.complete ACTTCCTTTCTAAATCGCACGTTGAACAGAAAAGATGGCGTCGAAGGTTT CGCGTGATACGCTGTATGAGGGCGTCAATGGACTCCTGGAGGCTTCGGCG AAGAAGAAGCGCGGCTTCCTCGAGACGGTGGAACTGCAGATCGGCCTGAA GAACTACGATCCCCAGAAGGACAAGCGTTTCTCCGGCACCGTCAAGTTGA AGCACATTCCTCGTCCCAAGATGAAGGTGTGCATCCTTGGCGATCAGCAG CATTGCGACGAAGCCAAGGCCAACAACGTCGACTTCATGGATGCCGAGGC TCTGAAGAAGCTGAACAAGAACAAGAAGCTGGTGAAGAAGCTGGCCAAGT CCTATGATGCCTTCCTGGCCTCTGAGTCGCTGATCAAGCAGATTCCTCGT TTGCTTGGCCCTGGCTTGAACAAGGCCGGCAAGTTCCCTGCCCTGCTGTC GCATCAGGAGTCTATGATTGGCAAGATCGAGGAGGTTAAGTCGACCATCA AGTTCCAGATGAAGAAGGTGCTCTGCCTGTCCGTCGCCGTCGGCCACGTT GGCATGAAGTCCGACGAGCTGGCCCAAAACGTCAACTTGTCGATCAACTT CTTGGTGTCGCTGTTGAAGAAGAACTGGCAGAATGTGCGCTCCCTGCACG TCAAGTCCTCCATGGGACCGCCCCAGCGTCTTTACTAGATGCGCATACTT CATTTTTCTTACATCTTGAAATAAATAAGATCCTACATTTTTGTAATGTA AAAAAAAAGAAGAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL10Ab-RA | 949 | RpL10Ab-RA | 151..901 | 1..751 | 3755 | 100 | Plus |
RpL10Ab.a | 861 | RpL10Ab.a | 146..857 | 40..751 | 3560 | 100 | Plus |
RpL10Ab-RD | 1029 | RpL10Ab-RD | 473..1028 | 196..751 | 2780 | 100 | Plus |
RpL10Ab-RD | 1029 | RpL10Ab-RD | 68..264 | 1..197 | 985 | 100 | Plus |
RpL10Ab.a | 861 | RpL10Ab.a | 56..96 | 1..41 | 205 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 11814511..11815066 | 196..751 | 2780 | 100 | Plus |
chr3L | 24539361 | chr3L | 11814053..11814210 | 40..197 | 790 | 100 | Plus |
chr3L | 24539361 | chr3L | 11813705..11813745 | 1..41 | 205 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 11813705..11813743 | 1..39 | 100 | -> | Plus |
chr3L | 11814053..11814208 | 40..195 | 100 | -> | Plus |
chr3L | 11814511..11815071 | 196..756 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL10Ab-RA | 1..654 | 35..688 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL10Ab-RA | 1..654 | 35..688 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL10Ab-RA | 1..654 | 35..688 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL10Ab-RA | 1..654 | 35..688 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL10Ab-RA | 1..749 | 1..749 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL10Ab-RA | 1..749 | 1..749 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL10Ab-RA | 2..750 | 1..749 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL10Ab-RA | 1..749 | 1..749 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL10Ab-RA | 2..750 | 1..749 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11822852..11822890 | 1..39 | 100 | -> | Plus |
3L | 11823200..11823355 | 40..195 | 100 | -> | Plus |
3L | 11823658..11824218 | 196..756 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11822852..11822890 | 1..39 | 100 | -> | Plus |
3L | 11823200..11823355 | 40..195 | 100 | -> | Plus |
3L | 11823658..11824218 | 196..756 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11822852..11822890 | 1..39 | 100 | -> | Plus |
3L | 11823200..11823355 | 40..195 | 100 | -> | Plus |
3L | 11823658..11824218 | 196..756 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 11815952..11815990 | 1..39 | 100 | -> | Plus |
arm_3L | 11816300..11816455 | 40..195 | 100 | -> | Plus |
arm_3L | 11816758..11817318 | 196..756 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11816758..11817318 | 196..756 | 99 | Plus | |
3L | 11815952..11815990 | 1..39 | 100 | -> | Plus |
3L | 11816300..11816455 | 40..195 | 100 | -> | Plus |
Translation from 34 to 687
> RE06042.pep MASKVSRDTLYEGVNGLLEASAKKKRGFLETVELQIGLKNYDPQKDKRFS GTVKLKHIPRPKMKVCILGDQQHCDEAKANNVDFMDAEALKKLNKNKKLV KKLAKSYDAFLASESLIKQIPRLLGPGLNKAGKFPALLSHQESMIGKIEE VKSTIKFQMKKVLCLSVAVGHVGMKSDELAQNVNLSINFLVSLLKKNWQN VRSLHVKSSMGPPQRLY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24510-PA | 217 | GF24510-PA | 1..217 | 1..217 | 1120 | 98.6 | Plus |
Dana\GF17830-PA | 217 | GF17830-PA | 1..217 | 1..217 | 697 | 61.6 | Plus |
Dana\GF23437-PA | 143 | GF23437-PA | 1..93 | 63..176 | 291 | 64.3 | Plus |
Dana\GF21648-PA | 89 | GF21648-PA | 1..53 | 63..114 | 153 | 77.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15534-PA | 217 | GG15534-PA | 1..217 | 1..217 | 1130 | 99.5 | Plus |
Dere\GG16888-PA | 216 | GG16888-PA | 1..216 | 1..217 | 719 | 65.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16724-PA | 217 | GH16724-PA | 1..217 | 1..217 | 982 | 94 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL10Ab-PA | 217 | CG7283-PA | 1..217 | 1..217 | 1099 | 100 | Plus |
RpL10Aa-PA | 216 | CG3843-PA | 1..216 | 1..217 | 676 | 63.6 | Plus |
RpL10Ab-PF | 57 | CG7283-PF | 1..54 | 1..54 | 270 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL20818-PA | 154 | GL20818-PA | 1..147 | 1..147 | 645 | 95.2 | Plus |
Dper\GL20819-PA | 59 | GL20819-PA | 1..59 | 159..217 | 306 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20236-PA | 217 | GA20236-PA | 1..217 | 1..217 | 1012 | 96.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25301-PA | 217 | GM25301-PA | 1..217 | 1..217 | 1135 | 100 | Plus |
Dsec\GM24197-PA | 216 | GM24197-PA | 1..216 | 1..217 | 686 | 61.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14333-PA | 217 | GD14333-PA | 1..217 | 1..217 | 1135 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11814-PA | 217 | GJ11814-PA | 1..217 | 1..217 | 980 | 93.5 | Plus |
Translation from 34 to 687
> RE06042.hyp MASKVSRDTLYEGVNGLLEASAKKKRGFLETVELQIGLKNYDPQKDKRFS GTVKLKHIPRPKMKVCILGDQQHCDEAKANNVDFMDAEALKKLNKNKKLV KKLAKSYDAFLASESLIKQIPRLLGPGLNKAGKFPALLSHQESMIGKIEE VKSTIKFQMKKVLCLSVAVGHVGMKSDELAQNVNLSINFLVSLLKKNWQN VRSLHVKSSMGPPQRLY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL10Ab-PA | 217 | CG7283-PA | 1..217 | 1..217 | 1099 | 100 | Plus |
RpL10Aa-PA | 216 | CG3843-PA | 1..216 | 1..217 | 676 | 63.6 | Plus |
RpL10Ab-PF | 57 | CG7283-PF | 1..54 | 1..54 | 270 | 100 | Plus |