Clone RE06383 Report

Search the DGRC for RE06383

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:63
Well:83
Vector:pFlc-1
Associated Gene/Transcriptcomm2-RA
Protein status:RE06383.pep: gold
Preliminary Size:1201
Sequenced Size:1531

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7554 2002-01-01 Sim4 clustering to Release 2
CG7554 2002-04-22 Blastp of sequenced clone
CG7554 2003-01-01 Sim4 clustering to Release 3
comm2 2008-04-29 Release 5.5 accounting
comm2 2008-08-15 Release 5.9 accounting
comm2 2008-12-18 5.12 accounting

Clone Sequence Records

RE06383.complete Sequence

1531 bp (1531 high quality bases) assembled on 2002-04-22

GenBank Submission: AY113389

> RE06383.complete
AGTTTGTTTGTAGACTCAGACGTCGACGGACGTGTGCGTTCGTTTAAAGA
AACCGGAGACTAAGAACGATCCACGAGATACAGATACCGATATCGCAGCA
GTGAAAGTGTGCCGCAACGGATACAACAGCAGAGATATAGATACAAATAG
AGATTACACCCGCCAGTCGACCGATATAAAAGTAAACCATGGAGGAATTG
CCGCGCGCATTAAACTACGAACTCTCGCACGATTTGCATTTCGATCATTA
CGCCGGTGCCGCAGCTCAGAAGATTCTGAACAGCGGGAGAAGTTCTCCTG
AAGCGTCCACCCCGACCATCACCACATTGGATGCCATCTCCAGCAGTGAT
TTCCTGAAACAGATTGGCCAGCAGATCCTCAGTTCCATCCAACTGAAACA
TCAGCATCAGCTCAACGAAGTCAGCCATCCGAGGAATTCCACCAGCGAGG
AGATCATGGATTTCGATCTGGCCAATCGGGTGATTCTGGACAGCAGCAGT
GTGGATCAGCTGCAGCAGCAGTTGGAGTACGATAAATTCATGAACGAGGT
GTGGATCGGCATCGTCTTCACCCTGATCCTCATCTCGATGGTCTTCTGCA
TCTGCTCCTGCTTCCTGTACCATCAGTTCCGCACCTGGAAACGCAATTAT
CGCAACAATGCAAATGGCTCGACGCAGTGCACCATTGTAGATATAGAGGC
GTTGAAACTGCATCCGGATGTGGAGGATCCGGTTCCGGAATACACCCTAG
TATCTGGATTGCCCAGCTACGAGGCGGCTCTGGAGCTGCTACAAAAATCC
CCGCAGTCATCCTGCCTGATTGTCTATCCGAGTGTGTTCAATGTGTTCAA
TAAGCAGGAGAGGAGCAGCCAGGAGCTGCAGCATCCAGGAGTTGCAACAT
CAGCACCTCCAGCCGCACCCGAGAATCACCTGGCACCGCAGACACCTTCG
TTTTGTGATGCCACAATGCCGCTGCTCCCAGCAACAACAGCAGCAGCAGC
AACACATGCAGCAGCAACAGTAACAGCAGTAACAGCAGCAACAGCAACAT
CTGCAACATTGGCAGCTTCGCCCACGTGCGAGTCGATTAAGCCAAACTTT
GTGATGATGCCAATTGTGCCCAGTTATGCGGAGGTATTCGGCAGCTCGTA
CAAAACCGTCGACGAGAAAAAGAAATCGAAGTCAAAAGACAGCCAGTCGA
AAGACGATATCAAGCGGTAAAGGTAAAAGTGACGAGAATACGAATACGAA
TACCTAGCCAAGCAACTGAGCTCTGTGATATTTTCATGTTCATGCTGGAA
AGACATACCCATATGTAATTAAACTAAGCGCTGTGATTATCAAAAAGACG
TAACTAAACATACTACTCGCTACTAAATGTGTTAGCTGAATAGTTTCGCC
ACATTGTACTTAATGATATCGTATCCAGTACTTATGGAAACGCAAAGATG
CATATTGTTACTAGACTTAAGTAGGCCACAAACTAATTATTAATAAATTA
TACACCTAACAATTTAAAAAAAAAAAAAAAA

RE06383.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:13:32
Subject Length Description Subject Range Query Range Score Percent Strand
comm2.a 2094 comm2.a 532..2049 1..1518 7575 99.9 Plus
comm2-RA 1701 comm2-RA 139..1656 1..1518 7575 99.9 Plus
Hr38-RD 6872 Hr38-RD 1167..1237 988..1058 190 84.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:22:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15687452..15688318 1515..649 4320 99.9 Minus
chr3L 24539361 chr3L 15689060..15689711 648..1 3135 99.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:29:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:22:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15697591..15698460 1518..649 4350 100 Minus
3L 28110227 3L 15699202..15699849 648..1 3225 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:43:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15690691..15691560 1518..649 4350 100 Minus
3L 28103327 3L 15692302..15692949 648..1 3225 99.8 Minus
Blast to na_te.dros performed 2019-03-16 04:22:14
Subject Length Description Subject Range Query Range Score Percent Strand
Fw2 3961 Fw2 FW2 3961bp 1204..1250 61..108 120 75 Plus

RE06383.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:23:10 Download gff for RE06383.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15687452..15687908 1059..1515 100 == Minus
chr3L 15687989..15688318 649..978 99 <- Minus
chr3L 15689060..15689711 1..648 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:49:44 Download gff for RE06383.complete
Subject Subject Range Query Range Percent Splice Strand
comm2-RA 1..1032 189..1220 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:59:21 Download gff for RE06383.complete
Subject Subject Range Query Range Percent Splice Strand
comm2-RA 1..1032 189..1220 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:27:07 Download gff for RE06383.complete
Subject Subject Range Query Range Percent Splice Strand
comm2-RA 1..1032 189..1220 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:52:43 Download gff for RE06383.complete
Subject Subject Range Query Range Percent Splice Strand
comm2-RA 1..1032 189..1220 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:36:55 Download gff for RE06383.complete
Subject Subject Range Query Range Percent Splice Strand
comm2-RA 1..1032 189..1220 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:40:02 Download gff for RE06383.complete
Subject Subject Range Query Range Percent Splice Strand
comm2-RA 1..1515 1..1515 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:59:21 Download gff for RE06383.complete
Subject Subject Range Query Range Percent Splice Strand
comm2-RA 1..1515 1..1515 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:27:07 Download gff for RE06383.complete
Subject Subject Range Query Range Percent Splice Strand
comm2-RA 2..1516 1..1515 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:52:43 Download gff for RE06383.complete
Subject Subject Range Query Range Percent Splice Strand
comm2-RA 1..1515 1..1515 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:36:55 Download gff for RE06383.complete
Subject Subject Range Query Range Percent Splice Strand
comm2-RA 2..1516 1..1515 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:23:10 Download gff for RE06383.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15697594..15698460 649..1515 100 <- Minus
3L 15699202..15699849 1..648 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:23:10 Download gff for RE06383.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15697594..15698460 649..1515 100 <- Minus
3L 15699202..15699849 1..648 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:23:10 Download gff for RE06383.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15697594..15698460 649..1515 100 <- Minus
3L 15699202..15699849 1..648 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:27:07 Download gff for RE06383.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15690694..15691560 649..1515 100 <- Minus
arm_3L 15692302..15692949 1..648 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:24:45 Download gff for RE06383.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15690694..15691560 649..1515 100 <- Minus
3L 15692302..15692949 1..648 99   Minus

RE06383.pep Sequence

Translation from 188 to 1219

> RE06383.pep
MEELPRALNYELSHDLHFDHYAGAAAQKILNSGRSSPEASTPTITTLDAI
SSSDFLKQIGQQILSSIQLKHQHQLNEVSHPRNSTSEEIMDFDLANRVIL
DSSSVDQLQQQLEYDKFMNEVWIGIVFTLILISMVFCICSCFLYHQFRTW
KRNYRNNANGSTQCTIVDIEALKLHPDVEDPVPEYTLVSGLPSYEAALEL
LQKSPQSSCLIVYPSVFNVFNKQERSSQELQHPGVATSAPPAAPENHLAP
QTPSFCDATMPLLPATTAAAATHAAATVTAVTAATATSATLAASPTCESI
KPNFVMMPIVPSYAEVFGSSYKTVDEKKKSKSKDSQSKDDIKR*

RE06383.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:34:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10377-PA 329 GF10377-PA 1..329 1..343 1176 72.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:34:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13522-PA 342 GG13522-PA 1..340 1..343 1574 93.3 Plus
Dere\GG13532-PA 425 GG13532-PA 144..255 113..229 210 33.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:34:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14476-PA 338 GH14476-PA 1..332 1..342 1081 64.3 Plus
Dgri\GH23316-PA 431 GH23316-PA 145..265 115..238 216 35.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
comm2-PA 343 CG7554-PA 1..343 1..343 1762 100 Plus
comm3-PE 423 CG42334-PE 144..310 113..286 222 30.2 Plus
comm3-PD 423 CG42334-PD 144..310 113..286 222 30.2 Plus
comm-PB 370 CG17943-PB 117..364 101..300 165 25.3 Plus
comm-PA 370 CG17943-PA 117..364 101..300 165 25.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:34:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13622-PA 333 GI13622-PA 1..315 1..326 986 66 Plus
Dmoj\GI13626-PA 435 GI13626-PA 153..264 110..229 218 36.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:34:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25481-PA 344 GL25481-PA 1..344 1..343 1300 72.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:34:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20435-PA 348 GA20435-PA 1..348 1..343 1285 72.2 Plus
Dpse\GA17371-PA 422 GA17371-PA 142..237 113..216 211 37.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:34:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24466-PA 274 GM24466-PA 1..228 1..238 1160 92 Plus
Dsec\GM24476-PA 423 GM24476-PA 144..255 113..229 209 33.1 Plus
Dsec\GM24465-PA 370 GM24465-PA 117..272 101..233 166 30.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:34:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12539-PA 339 GD12539-PA 1..339 1..343 1770 97.7 Plus
Dsim\GD12538-PA 370 GD12538-PA 133..272 117..233 166 31.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:34:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13958-PA 334 GJ13958-PA 1..328 1..343 1006 64.2 Plus
Dvir\GJ13964-PA 439 GJ13964-PA 150..279 110..244 217 32.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:34:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20674-PA 361 GK20674-PA 1..359 1..339 930 62.1 Plus
Dwil\GK20752-PA 455 GK20752-PA 161..281 113..238 218 34.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:34:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19814-PA 341 GE19814-PA 1..341 1..343 1496 92.1 Plus
Dyak\GE22823-PA 339 GE22823-PA 1..339 1..343 1491 92.4 Plus
Dyak\GE14686-PA 156 GE14686-PA 1..133 1..133 687 97 Plus
Dyak\GE19827-PA 423 GE19827-PA 144..239 113..216 209 37.1 Plus
Dyak\GE19813-PA 378 GE19813-PA 117..272 101..233 167 30.6 Plus

RE06383.hyp Sequence

Translation from 188 to 1219

> RE06383.hyp
MEELPRALNYELSHDLHFDHYAGAAAQKILNSGRSSPEASTPTITTLDAI
SSSDFLKQIGQQILSSIQLKHQHQLNEVSHPRNSTSEEIMDFDLANRVIL
DSSSVDQLQQQLEYDKFMNEVWIGIVFTLILISMVFCICSCFLYHQFRTW
KRNYRNNANGSTQCTIVDIEALKLHPDVEDPVPEYTLVSGLPSYEAALEL
LQKSPQSSCLIVYPSVFNVFNKQERSSQELQHPGVATSAPPAAPENHLAP
QTPSFCDATMPLLPATTAAAATHAAATVTAVTAATATSATLAASPTCESI
KPNFVMMPIVPSYAEVFGSSYKTVDEKKKSKSKDSQSKDDIKR*

RE06383.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:02:58
Subject Length Description Subject Range Query Range Score Percent Strand
comm2-PA 343 CG7554-PA 1..343 1..343 1762 100 Plus
comm3-PE 423 CG42334-PE 144..310 113..286 222 30.2 Plus
comm3-PD 423 CG42334-PD 144..310 113..286 222 30.2 Plus
comm-PB 370 CG17943-PB 117..364 101..300 165 25.3 Plus
comm-PA 370 CG17943-PA 117..364 101..300 165 25.3 Plus