Clone RE06389 Report

Search the DGRC for RE06389

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:63
Well:89
Vector:pFlc-1
Associated Gene/TranscriptCG2310-RA
Protein status:RE06389.pep: gold
Sequenced Size:1092

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2310 2001-12-14 Blastp of sequenced clone
CG2310 2002-01-01 Sim4 clustering to Release 2
CG2310 2003-01-01 Sim4 clustering to Release 3
CG2310 2008-04-29 Release 5.5 accounting
CG2310 2008-08-15 Release 5.9 accounting
CG2310 2008-12-18 5.12 accounting

Clone Sequence Records

RE06389.complete Sequence

1092 bp (1092 high quality bases) assembled on 2001-12-14

GenBank Submission: AY070964

> RE06389.complete
CAGTCGTTTCTTCGCCGCTCAACCGTTCGGTCGCTTCTTCGGTCGCCCGC
CTATCGATATCGATAAACATACTCCTGCGAGCAGATACCATTCGCACGAT
GTCGTACTACGCGGAGCGAGCCCTGTCCCTACTCTACCCGCTGGCCATCG
TTTCATCGCTGGTCTGCTGCATCACCTCGGCGGTGGCCTGGACACACTGG
CAGTACGTGCTCAATGCCTGCCCGGACACCAATTGCGGCTGCGTGCTGCA
CGGCAAGAGCACGTTCCACAGCTTCGAGGGCGGCAACGTCGCCTACTGCC
ACTTCGCCACCTACGGCCTGCTGCTGCCGCTGCTCTTCGCCGTCGTCCTG
GGCGTCTACCACGGCTACCGCATGTGCATCGGTCGGGGCAAGCCCAAGGC
GGGCACGGCCACCATCCGTCAGCGCTCCGGTGACATGATCGTGGTGACCA
CCGAGTCGGAACTCACGCCCGATGGTCTCTCGCCCTACTACTGGCTGCCC
GCCACCGTCATCTCGACAATAATGGCCGTCTACCAACTGGTCTACTCGGC
CGTGTTCACGGATGGCTTCGAGGTGACTTGCAAGCAGTACAGGGAGTCGC
TGCTGAAGGAGATCCAGGGCGTGGGCAACATTGTGCCCGTGATCAAGTCG
CGGCTCTCGTGCGCCGCCGTCTTCGACTTCATGGACTATCTGGTGGAGAG
CGTGTCGTACGAGCGGCGACGCTACGGGCGCATCAATACGGCCGCCTGCC
TGTACTTCACCCTGGTCTTTGCCTGGATCGCACTGCTCGCATGGCTGCTC
GTCTGCGTGATCAATGTCGTCCAGCTGCGGCGCACGAAGGCCGCCAGGGT
CTGAGTCCTGCCATGAATCGGGAGGCGCGAGGTCCTCTACACTTTACATT
CCACCTGTTCGCCTTTTAACTTATTTAGTTAGTTATAGTGACACACAAGC
CAGAACGTCCACGTTATGAACGCATTGTACAAATAATATACATATGTATG
AACAACGAGCGATTATTCACATCGCAAGCCTTTTCAATAAAATGACTATA
ATTGCATTAAAGATATGCATGCATACAAAAAAAAAAAAAAAA

RE06389.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:39:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG2310-RA 1227 CG2310-RA 93..1169 1..1077 5385 100 Plus
CG2310.a 1227 CG2310.a 161..1169 69..1077 5045 100 Plus
CG2310-RB 1314 CG2310-RB 254..1262 69..1077 5045 100 Plus
CG2310.a 1227 CG2310.a 19..86 1..68 340 100 Plus
CG2310-RB 1314 CG2310-RB 1..57 12..68 285 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:54:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25314125..25314727 1076..493 2545 95.2 Minus
chr3R 27901430 chr3R 25315014..25315369 424..69 1720 98.9 Minus
chr3R 27901430 chr3R 25316066..25316133 68..1 340 100 Minus
chr3R 27901430 chr3R 25314788..25314857 493..424 335 98.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:29:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:54:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29491525..29492109 1077..493 2925 100 Minus
3R 32079331 3R 29492396..29492751 424..69 1780 100 Minus
3R 32079331 3R 29492170..29492239 493..424 350 100 Minus
3R 32079331 3R 29493446..29493513 68..1 340 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29232356..29232940 1077..493 2925 100 Minus
3R 31820162 3R 29233227..29233582 424..69 1780 100 Minus
3R 31820162 3R 29233001..29233070 493..424 350 100 Minus
3R 31820162 3R 29234277..29234344 68..1 340 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:54:01 has no hits.

RE06389.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:54:52 Download gff for RE06389.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25314789..25314856 425..492 98 <- Minus
chr3R 25315014..25315369 69..424 98 <- Minus
chr3R 25316066..25316133 1..68 100   Minus
chr3R 25314125..25314315 888..1076 97 <- Minus
chr3R 25314331..25314727 493..887 97 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:49:46 Download gff for RE06389.complete
Subject Subject Range Query Range Percent Splice Strand
CG2310-RB 1..756 99..854 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:03:13 Download gff for RE06389.complete
Subject Subject Range Query Range Percent Splice Strand
CG2310-RB 1..756 99..854 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:45:42 Download gff for RE06389.complete
Subject Subject Range Query Range Percent Splice Strand
CG2310-RA 1..756 99..854 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:27:52 Download gff for RE06389.complete
Subject Subject Range Query Range Percent Splice Strand
CG2310-RB 1..756 99..854 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:20:36 Download gff for RE06389.complete
Subject Subject Range Query Range Percent Splice Strand
CG2310-RA 1..756 99..854 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:30:17 Download gff for RE06389.complete
Subject Subject Range Query Range Percent Splice Strand
CG2310-RA 1..1076 1..1076 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:03:13 Download gff for RE06389.complete
Subject Subject Range Query Range Percent Splice Strand
CG2310-RA 1..1076 1..1076 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:45:42 Download gff for RE06389.complete
Subject Subject Range Query Range Percent Splice Strand
CG2310-RA 6..1081 1..1076 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:27:53 Download gff for RE06389.complete
Subject Subject Range Query Range Percent Splice Strand
CG2310-RA 1..1076 1..1076 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:20:36 Download gff for RE06389.complete
Subject Subject Range Query Range Percent Splice Strand
CG2310-RA 6..1081 1..1076 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:54:52 Download gff for RE06389.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29493446..29493513 1..68 100   Minus
3R 29491526..29492109 493..1076 100 <- Minus
3R 29492171..29492238 425..492 100 <- Minus
3R 29492396..29492751 69..424 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:54:52 Download gff for RE06389.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29493446..29493513 1..68 100   Minus
3R 29491526..29492109 493..1076 100 <- Minus
3R 29492171..29492238 425..492 100 <- Minus
3R 29492396..29492751 69..424 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:54:52 Download gff for RE06389.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29493446..29493513 1..68 100   Minus
3R 29491526..29492109 493..1076 100 <- Minus
3R 29492171..29492238 425..492 100 <- Minus
3R 29492396..29492751 69..424 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:45:42 Download gff for RE06389.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25317248..25317831 493..1076 100 <- Minus
arm_3R 25317893..25317960 425..492 100 <- Minus
arm_3R 25318118..25318473 69..424 100 <- Minus
arm_3R 25319168..25319235 1..68 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:03:41 Download gff for RE06389.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29232357..29232940 493..1076 100 <- Minus
3R 29233002..29233069 425..492 100 <- Minus
3R 29233227..29233582 69..424 100 <- Minus
3R 29234277..29234344 1..68 100   Minus

RE06389.hyp Sequence

Translation from 2 to 853

> RE06389.hyp
VVSSPLNRSVASSVARLSISINILLRADTIRTMSYYAERALSLLYPLAIV
SSLVCCITSAVAWTHWQYVLNACPDTNCGCVLHGKSTFHSFEGGNVAYCH
FATYGLLLPLLFAVVLGVYHGYRMCIGRGKPKAGTATIRQRSGDMIVVTT
ESELTPDGLSPYYWLPATVISTIMAVYQLVYSAVFTDGFEVTCKQYRESL
LKEIQGVGNIVPVIKSRLSCAAVFDFMDYLVESVSYERRRYGRINTAACL
YFTLVFAWIALLAWLLVCVINVVQLRRTKAARV*

RE06389.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:18:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG2310-PB 251 CG2310-PB 1..251 33..283 1323 100 Plus
CG2310-PA 251 CG2310-PA 1..251 33..283 1323 100 Plus

RE06389.pep Sequence

Translation from 98 to 853

> RE06389.pep
MSYYAERALSLLYPLAIVSSLVCCITSAVAWTHWQYVLNACPDTNCGCVL
HGKSTFHSFEGGNVAYCHFATYGLLLPLLFAVVLGVYHGYRMCIGRGKPK
AGTATIRQRSGDMIVVTTESELTPDGLSPYYWLPATVISTIMAVYQLVYS
AVFTDGFEVTCKQYRESLLKEIQGVGNIVPVIKSRLSCAAVFDFMDYLVE
SVSYERRRYGRINTAACLYFTLVFAWIALLAWLLVCVINVVQLRRTKAAR
V*

RE06389.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:23:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22887-PA 251 GF22887-PA 1..251 1..251 1244 89.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:23:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12016-PA 251 GG12016-PA 1..251 1..251 1281 95.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:23:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18697-PA 251 GH18697-PA 1..251 1..251 1128 83.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG2310-PB 251 CG2310-PB 1..251 1..251 1323 100 Plus
CG2310-PA 251 CG2310-PA 1..251 1..251 1323 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:23:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24464-PA 251 GI24464-PA 1..251 1..251 1154 82.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:23:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13589-PA 251 GL13589-PA 1..251 1..251 1185 83.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:23:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15346-PA 251 GA15346-PA 1..251 1..251 1185 83.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:23:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12241-PA 251 GM12241-PA 1..251 1..251 1316 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:23:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17764-PA 251 GD17764-PA 1..251 1..251 1317 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:23:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10557-PA 251 GJ10557-PA 1..251 1..251 1202 86.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:23:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11182-PA 251 GK11182-PA 1..251 1..251 1180 84.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:23:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10452-PA 251 GE10452-PA 1..251 1..251 1268 92.4 Plus