Clone RE06553 Report

Search the DGRC for RE06553

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:65
Well:53
Vector:pFlc-1
Associated Gene/TranscriptCG18609-RA
Protein status:RE06553.pep: gold
Preliminary Size:809
Sequenced Size:995

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18609 2002-01-01 Sim4 clustering to Release 2
CG18609 2003-01-01 Sim4 clustering to Release 3
CG18609 2004-01-20 Blastp of sequenced clone
CG18609 2008-04-29 Release 5.5 accounting
CG18609 2008-08-15 Release 5.9 accounting
CG18609 2008-12-18 5.12 accounting

Clone Sequence Records

RE06553.complete Sequence

995 bp (995 high quality bases) assembled on 2004-01-20

GenBank Submission: BT011482

> RE06553.complete
AGTGGCCAGCGGTTCCTCAAACAACAATCAACCATTTAATAATGCTCCGA
TACTTGCGCATACCTCAAGCGGATCCTAACCCAATTCCGCTGGCTGGATC
ACCATGGCCTATCACACTGATTTTGATAGCATATCTGTTGTTTGTCCTTA
AATTGGGCAAGATCTTTATGAGAAACCGGAAACCATATGATTTGAAAACG
GTCTTGAAGGTCTACAATCTATTTCAGGTGCTATACAATGGTCTCTACTT
CGGAATGGTTTTTTATTATCTCTTCATCGTGGGCATTTGCAATCTGCACT
GCATAGAAAGCTTTCCCGAGGGCCATGAACGCAAACAATTGGAACGAGTA
TTGCATGCCGCATATCTGCTGAACAAGGTCCTCGATCTTATGGATACGGT
GTTCTTTGTGCTGCGAAAGAGCTATAAGCAGATCACCTTCCTGCACATAT
ATCACCACGTGTTCATGTCCTTTGGAAGTTATGCCCTAACCCGTTACTAT
GGAACTGGAGGCCATGTCAATGCCGTTGGACTGCTGAACTCCTTGGTGCA
CACGGTCATGTATTTCTACTACTTTCTGTCTTCAGAATATCCCGGAGTGA
GGGCCAATATCTGGTGGAAGAAGTATATAACATTGACACAGCTCTGCCAG
TTCTTCATGCTGCTCAGTTATGCCATCTATGTGCGATTCTTTTCACCGAA
TTGTGGCGTTCCACGCGGTCTTCTCTATCTAAATATGGTGCAAGGCGTTG
TGTTCATTTATCTGTTTGGTAAATTCTATATCGACAACTATCTGAGACCT
CCGAAGGCGAAAATCAACGCAAAGCAATCGTAGCCTTAAGTCATTTAAAT
ATACGTAAATGCGCATTTAATTAGTCCATGTATTTAACTAAGCAATCACT
ATGACTTCTGCTCTCTCAAATGTGACTTCGGACCGAAGATATAACTAAAC
TGAACGAAACAATAAAATGGTATTGTCCCAAAAAAAAAAAAAAAA

RE06553.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:06:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG18609-RA 1015 CG18609-RA 33..1011 1..979 4865 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:29:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14629623..14630345 979..257 3450 98.5 Minus
chr2R 21145070 chr2R 14630405..14630592 259..72 910 98.9 Minus
chr2R 21145070 chr2R 14630651..14630722 72..1 345 98.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:29:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:29:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18742517..18743239 979..257 3600 99.9 Minus
2R 25286936 2R 18743299..18743486 259..72 940 100 Minus
2R 25286936 2R 18743545..18743616 72..1 345 98.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:52:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18743716..18744438 979..257 3600 99.8 Minus
2R 25260384 2R 18744498..18744685 259..72 940 100 Minus
2R 25260384 2R 18744744..18744815 72..1 345 98.6 Minus
Blast to na_te.dros performed on 2019-03-16 21:29:55 has no hits.

RE06553.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:30:53 Download gff for RE06553.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14629623..14630344 258..979 98 <- Minus
chr2R 14630407..14630591 73..257 98 <- Minus
chr2R 14630651..14630722 1..72 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:49:55 Download gff for RE06553.complete
Subject Subject Range Query Range Percent Splice Strand
CG18609-RA 1..792 42..833 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:41:10 Download gff for RE06553.complete
Subject Subject Range Query Range Percent Splice Strand
CG18609-RA 1..792 42..833 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:59:42 Download gff for RE06553.complete
Subject Subject Range Query Range Percent Splice Strand
CG18609-RA 1..792 42..833 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:30:00 Download gff for RE06553.complete
Subject Subject Range Query Range Percent Splice Strand
CG18609-RA 1..792 42..833 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:20:43 Download gff for RE06553.complete
Subject Subject Range Query Range Percent Splice Strand
CG18609-RA 1..792 42..833 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:50:22 Download gff for RE06553.complete
Subject Subject Range Query Range Percent Splice Strand
CG18609-RA 1..833 1..833 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:41:09 Download gff for RE06553.complete
Subject Subject Range Query Range Percent Splice Strand
CG18609-RA 1..979 1..979 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:59:42 Download gff for RE06553.complete
Subject Subject Range Query Range Percent Splice Strand
CG18609-RA 11..989 1..979 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:30:00 Download gff for RE06553.complete
Subject Subject Range Query Range Percent Splice Strand
CG18609-RA 1..833 1..833 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:20:43 Download gff for RE06553.complete
Subject Subject Range Query Range Percent Splice Strand
CG18609-RA 11..989 1..979 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:30:53 Download gff for RE06553.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18742517..18743238 258..979 99 <- Minus
2R 18743301..18743485 73..257 100 <- Minus
2R 18743545..18743616 1..72 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:30:53 Download gff for RE06553.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18742517..18743238 258..979 99 <- Minus
2R 18743301..18743485 73..257 100 <- Minus
2R 18743545..18743616 1..72 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:30:53 Download gff for RE06553.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18742517..18743238 258..979 99 <- Minus
2R 18743301..18743485 73..257 100 <- Minus
2R 18743545..18743616 1..72 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:59:42 Download gff for RE06553.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14630022..14630743 258..979 99 <- Minus
arm_2R 14630806..14630990 73..257 100 <- Minus
arm_2R 14631050..14631121 1..72 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:02:25 Download gff for RE06553.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18743716..18744437 258..979 99 <- Minus
2R 18744500..18744684 73..257 100 <- Minus
2R 18744744..18744815 1..72 98   Minus

RE06553.hyp Sequence

Translation from 2 to 832

> RE06553.hyp
SPAVPQTTINHLIMLRYLRIPQADPNPIPLAGSPWPITLILIAYLLFVLK
LGKIFMRNRKPYDLKTVLKVYNLFQVLYNGLYFGMVFYYLFIVGICNLHC
IESFPEGHERKQLERVLHAAYLLNKVLDLMDTVFFVLRKSYKQITFLHIY
HHVFMSFGSYALTRYYGTGGHVNAVGLLNSLVHTVMYFYYFLSSEYPGVR
ANIWWKKYITLTQLCQFFMLLSYAIYVRFFSPNCGVPRGLLYLNMVQGVV
FIYLFGKFYIDNYLRPPKAKINAKQS*

RE06553.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:50:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG18609-PA 263 CG18609-PA 1..263 14..276 1406 100 Plus
CG16904-PA 262 CG16904-PA 8..260 21..274 628 48 Plus
CG17821-PA 262 CG17821-PA 14..256 23..265 587 44.4 Plus
CG8534-PA 265 CG8534-PA 14..252 24..264 582 46.9 Plus
eloF-PA 257 CG16905-PA 6..255 24..276 560 43.9 Plus

RE06553.pep Sequence

Translation from 41 to 832

> RE06553.pep
MLRYLRIPQADPNPIPLAGSPWPITLILIAYLLFVLKLGKIFMRNRKPYD
LKTVLKVYNLFQVLYNGLYFGMVFYYLFIVGICNLHCIESFPEGHERKQL
ERVLHAAYLLNKVLDLMDTVFFVLRKSYKQITFLHIYHHVFMSFGSYALT
RYYGTGGHVNAVGLLNSLVHTVMYFYYFLSSEYPGVRANIWWKKYITLTQ
LCQFFMLLSYAIYVRFFSPNCGVPRGLLYLNMVQGVVFIYLFGKFYIDNY
LRPPKAKINAKQS*

RE06553.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:40:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13758-PA 261 GF13758-PA 1..261 1..261 1004 70.5 Plus
Dana\GF15498-PA 253 GF15498-PA 5..251 10..257 541 43.1 Plus
Dana\GF13996-PA 269 GF13996-PA 8..259 11..263 528 44.3 Plus
Dana\GF15497-PA 253 GF15497-PA 5..252 10..257 515 42.6 Plus
Dana\GF13757-PA 260 GF13757-PA 14..254 10..252 498 45.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:40:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20950-PA 263 GG20950-PA 1..263 1..263 1296 92.8 Plus
Dere\GG17320-PA 260 GG17320-PA 1..260 1..259 626 48.3 Plus
Dere\GG17214-PA 265 GG17214-PA 10..265 7..263 538 43.2 Plus
Dere\GG20949-PA 262 GG20949-PA 14..256 10..252 532 44 Plus
Dere\GG11234-PA 253 GG11234-PA 1..252 1..257 481 38.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:40:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19804-PA 261 GH19804-PA 8..251 8..251 806 59 Plus
Dgri\GH22831-PA 416 GH22831-PA 185..411 30..257 528 44.7 Plus
Dgri\GH19803-PA 217 GH19803-PA 1..215 43..257 515 46.5 Plus
Dgri\GH22831-PA 416 GH22831-PA 6..182 7..182 431 49.7 Plus
Dgri\GH17398-PA 285 GH17398-PA 32..264 17..252 407 37.2 Plus
Dgri\GH19244-PA 298 GH19244-PA 14..256 4..250 392 39 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG18609-PA 263 CG18609-PA 1..263 1..263 1406 100 Plus
CG16904-PA 262 CG16904-PA 8..260 8..261 628 48 Plus
CG17821-PA 262 CG17821-PA 14..256 10..252 587 44.4 Plus
CG8534-PA 265 CG8534-PA 14..252 11..251 582 46.9 Plus
eloF-PA 257 CG16905-PA 6..255 11..263 560 43.9 Plus
CG9459-PA 265 CG9459-PA 5..260 1..257 540 40.5 Plus
CG9458-PA 264 CG9458-PA 15..260 11..257 526 42.5 Plus
CG31141-PA 253 CG31141-PA 1..248 1..253 518 40.2 Plus
CG5326-PA 277 CG5326-PA 32..276 17..262 446 37.8 Plus
bond-PC 322 CG6921-PC 28..257 17..250 422 37.4 Plus
bond-PA 322 CG6921-PA 28..257 17..250 422 37.4 Plus
bond-PB 322 CG6921-PB 28..257 17..250 422 37.4 Plus
sit-PA 295 CG5278-PA 20..262 10..256 412 38.6 Plus
CG6660-PA 272 CG6660-PA 8..268 1..261 397 35.3 Plus
CG33110-PA 337 CG33110-PA 61..299 16..257 370 34.3 Plus
CG31522-PF 365 CG31522-PF 27..254 16..246 367 33.9 Plus
CG31522-PB 365 CG31522-PB 27..254 16..246 367 33.9 Plus
CG31522-PD 365 CG31522-PD 27..254 16..246 367 33.9 Plus
CG2781-PA 329 CG2781-PA 27..270 16..261 366 34.5 Plus
CG31522-PH 364 CG31522-PH 27..253 16..246 365 33.8 Plus
CG31522-PG 364 CG31522-PG 27..253 16..246 365 33.8 Plus
CG31522-PA 364 CG31522-PA 27..253 16..246 365 33.8 Plus
CG31523-PF 354 CG31523-PF 19..268 9..260 358 32.7 Plus
CG31523-PE 354 CG31523-PE 19..268 9..260 358 32.7 Plus
CG31523-PG 354 CG31523-PG 19..268 9..260 358 32.7 Plus
CG31523-PD 354 CG31523-PD 19..268 9..260 358 32.7 Plus
CG31523-PA 354 CG31523-PA 19..268 9..260 358 32.7 Plus
CG31523-PB 354 CG31523-PB 19..268 9..260 358 32.7 Plus
CG31523-PC 354 CG31523-PC 19..268 9..260 358 32.7 Plus
CG31522-PI 392 CG31522-PI 27..281 16..246 339 30.9 Plus
Elo68beta-PB 269 CG11801-PB 30..259 16..250 297 32.9 Plus
Elo68alpha-PA 262 CG32072-PA 23..252 16..250 284 31.8 Plus
CG30008-PA 266 CG30008-PA 22..262 21..263 274 35.3 Plus
Baldspot-PB 316 CG3971-PB 35..266 22..253 154 24.7 Plus
Baldspot-PA 316 CG3971-PA 35..266 22..253 154 24.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:40:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20347-PA 245 GI20347-PA 1..242 16..257 803 59.1 Plus
Dmoj\GI20345-PA 249 GI20345-PA 6..247 16..257 643 50.8 Plus
Dmoj\GI20344-PA 262 GI20344-PA 11..260 10..257 643 51.2 Plus
Dmoj\GI10225-PA 258 GI10225-PA 8..256 8..257 606 48.4 Plus
Dmoj\GI20343-PA 262 GI20343-PA 1..259 17..255 574 42.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:40:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11311-PA 284 GL11311-PA 8..258 7..257 1054 77.3 Plus
Dper\GL23223-PA 262 GL23223-PA 1..260 1..261 622 47.5 Plus
Dper\GL11310-PA 263 GL11310-PA 6..262 1..257 546 44.7 Plus
Dper\GL23222-PA 264 GL23222-PA 1..262 1..261 506 43.4 Plus
Dper\GL13683-PA 277 GL13683-PA 32..277 17..263 417 37.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:40:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15013-PA 286 GA15013-PA 8..258 7..257 1054 77.3 Plus
Dpse\GA14209-PA 262 GA14209-PA 8..260 8..261 606 47.2 Plus
Dpse\GA14683-PA 263 GA14683-PA 6..262 1..257 547 44.7 Plus
Dpse\GA21802-PA 264 GA21802-PA 1..262 1..261 509 43.4 Plus
Dpse\GA18806-PA 277 GA18806-PA 32..277 17..263 417 37.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:40:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19880-PA 263 GM19880-PA 1..263 1..263 1335 96.6 Plus
Dsec\GM26206-PA 262 GM26206-PA 8..260 8..261 618 48.4 Plus
Dsec\GM23845-PA 265 GM23845-PA 10..264 7..263 571 45.5 Plus
Dsec\GM19879-PA 262 GM19879-PA 14..261 10..257 563 44 Plus
Dsec\GM23846-PA 258 GM23846-PA 6..255 11..263 527 43.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:40:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25363-PA 263 GD25363-PA 1..263 1..263 1347 97.3 Plus
Dsim\GD20753-PA 262 GD20753-PA 8..260 8..261 615 48.4 Plus
Dsim\GD18652-PA 265 GD18652-PA 10..252 7..251 562 46.5 Plus
Dsim\GD25362-PA 262 GD25362-PA 14..261 10..257 552 43.1 Plus
Dsim\GD18654-PA 263 GD18654-PA 6..257 11..263 516 42.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:40:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22071-PA 221 GJ22071-PA 1..221 43..263 745 60.2 Plus
Dvir\GJ22069-PA 248 GJ22069-PA 1..237 15..251 666 53.6 Plus
Dvir\GJ11026-PA 263 GJ11026-PA 8..261 8..262 657 48.6 Plus
Dvir\GJ11028-PA 261 GJ11028-PA 8..256 8..257 639 48.8 Plus
Dvir\GJ22068-PA 217 GJ22068-PA 1..215 43..257 580 52.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:40:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20710-PA 205 GK20710-PA 1..203 1..203 814 70.4 Plus
Dwil\GK20708-PA 255 GK20708-PA 1..250 1..251 509 42.6 Plus
Dwil\GK14039-PA 203 GK14039-PA 8..196 10..198 487 49.2 Plus
Dwil\GK20709-PA 266 GK20709-PA 6..244 23..263 464 42.7 Plus
Dwil\GK11596-PA 221 GK11596-PA 1..217 43..260 430 40.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:40:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13888-PA 263 GE13888-PA 1..263 1..263 1283 91.3 Plus
Dyak\GE24724-PA 262 GE24724-PA 1..260 1..261 613 46.7 Plus
Dyak\GE13887-PA 262 GE13887-PA 5..256 1..252 570 45.2 Plus
Dyak\GE25994-PA 264 GE25994-PA 10..264 7..263 525 45.9 Plus
Dyak\GE25995-PA 254 GE25995-PA 5..249 10..255 520 43.1 Plus