Clone RE06652 Report

Search the DGRC for RE06652

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:66
Well:52
Vector:pFlc-1
Associated Gene/TranscriptCG31360-RA
Protein status:RE06652.pep: gold
Sequenced Size:649

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7660 2002-01-01 Sim4 clustering to Release 2
CG31360 2002-04-21 Blastp of sequenced clone
CG31360 2003-01-01 Sim4 clustering to Release 3
CG31360 2008-04-29 Release 5.5 accounting
CG31360 2008-08-15 Release 5.9 accounting
CG31360 2008-12-18 5.12 accounting

Clone Sequence Records

RE06652.complete Sequence

649 bp (649 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113390

> RE06652.complete
AGTTATCGCCTTATTTTCCAAATCCATTCCCAAATTGTTATTATTGAAAT
AATTTTAAAAATGATCGGTAGACTTTCTTTTTGGAACAAGGACAACGTTT
CCAACGAGGTGGACTGCTTGGCCTGCCGTCTGGTCAGTGGCCTTGGACTC
CTGGGAATTGGTGCCTTCCTATTGGCACAGTCGAAAAAAAGACAAGCGAA
ACCTCTGGAGAATTTCACTATGAAAGGCTTGGCTGCAGCCGTTGGAGTTC
TGGGCGTGGCCCGCCTGGCAGACGCGAATTTCCTGAAGGCAACCGCCGAG
AAGCCAAAAGAACAGGAAAATACTAGCACTGATCATCAGTTCTTTTCTAG
ACGTTAATTCAATGACGTTTTAATTATAATCGTAGAGTCACTTAATATAT
AAAGGTTAATGTTTTCTTTTGTACGACCATGTGGCATTACAATAATATAG
CTGTAACCTTGTTTTTAGAATTTTTTCTATTTAAAATCGTTGAAAACAAA
ACCTTGTTTGCTTTAATGAATTTATGATTTATTTTAAATAAATTAATTAC
ATAGGCATACACAATATTGCATCTTTTGAAAGAGGATCATAAATAAACAT
ATGTTTGTATTAATAATAATATTATAAAATATCAAAAAAAAAAAAAAAA

RE06652.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG31360-RA 735 CG31360-RA 103..735 1..633 3150 99.8 Plus
CG31249.a 1165 CG31249.a 1045..1165 635..515 605 100 Minus
CG31249-RA 1237 CG31249-RA 1117..1237 635..515 605 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:13:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13509752..13510148 237..633 1970 99.7 Plus
chr3R 27901430 chr3R 13509454..13509691 1..238 1175 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:29:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:13:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17685411..17685809 237..635 1995 100 Plus
3R 32079331 3R 17685113..17685350 1..238 1175 99.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17426242..17426640 237..635 1995 100 Plus
3R 31820162 3R 17425944..17426181 1..238 1175 99.5 Plus
Blast to na_te.dros performed 2019-03-15 18:13:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 8210..8328 631..518 142 65 Minus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1081..1188 631..520 126 61.9 Minus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1067..1245 631..455 122 56.4 Minus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1154..1250 631..532 121 65.7 Minus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1132..1243 626..514 120 60.9 Minus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 132..199 512..580 117 65.2 Plus
Tc3 1743 Tc3 TC3 1743bp 274..320 631..585 109 70.2 Minus
invader6 4885 invader6 INVADER6 4885bp 1547..1573 601..627 108 88.9 Plus
Dbuz\BuT2 2775 Dbuz\BuT2 BUT2 2775bp 284..325 589..632 107 75 Plus
springer 7546 springer SPRINGER 7546bp Derived from BACR06P08 by Sue Celniker, 29 March 2001. 509..625 516..632 107 56.8 Plus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1140..1256 631..515 106 60 Minus

RE06652.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:14:44 Download gff for RE06652.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13509454..13509691 1..238 99 -> Plus
chr3R 13509754..13510122 239..607 91   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:49:57 Download gff for RE06652.complete
Subject Subject Range Query Range Percent Splice Strand
CG31360-RA 1..297 61..357 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:53:29 Download gff for RE06652.complete
Subject Subject Range Query Range Percent Splice Strand
CG31360-RA 1..297 61..357 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:56:54 Download gff for RE06652.complete
Subject Subject Range Query Range Percent Splice Strand
CG31360-RA 1..297 61..357 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:35:58 Download gff for RE06652.complete
Subject Subject Range Query Range Percent Splice Strand
CG31360-RA 1..297 61..357 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:56:20 Download gff for RE06652.complete
Subject Subject Range Query Range Percent Splice Strand
CG31360-RA 1..297 61..357 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:05:44 Download gff for RE06652.complete
Subject Subject Range Query Range Percent Splice Strand
CG31360-RA 12..644 1..633 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:53:29 Download gff for RE06652.complete
Subject Subject Range Query Range Percent Splice Strand
CG31360-RA 12..644 1..633 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:56:54 Download gff for RE06652.complete
Subject Subject Range Query Range Percent Splice Strand
CG31360-RA 17..649 1..633 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:35:58 Download gff for RE06652.complete
Subject Subject Range Query Range Percent Splice Strand
CG31360-RA 12..644 1..633 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:56:20 Download gff for RE06652.complete
Subject Subject Range Query Range Percent Splice Strand
CG31360-RA 17..649 1..633 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:14:44 Download gff for RE06652.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17685113..17685350 1..238 99 -> Plus
3R 17685413..17685807 239..633 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:14:44 Download gff for RE06652.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17685113..17685350 1..238 99 -> Plus
3R 17685413..17685807 239..633 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:14:44 Download gff for RE06652.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17685113..17685350 1..238 99 -> Plus
3R 17685413..17685807 239..633 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:56:54 Download gff for RE06652.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13511135..13511529 239..633 100   Plus
arm_3R 13510835..13511072 1..238 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:18:29 Download gff for RE06652.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17425944..17426181 1..238 99 -> Plus
3R 17426244..17426638 239..633 100   Plus

RE06652.hyp Sequence

Translation from 0 to 356

> RE06652.hyp
SCRLIFQIHSQIVIIEIILKMIGRLSFWNKDNVSNEVDCLACRLVSGLGL
LGIGAFLLAQSKKRQAKPLENFTMKGLAAAVGVLGVARLADANFLKATAE
KPKEQENTSTDHQFFSRR*

RE06652.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:35:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG31360-PA 98 CG31360-PA 1..98 21..118 496 100 Plus

RE06652.pep Sequence

Translation from 60 to 356

> RE06652.pep
MIGRLSFWNKDNVSNEVDCLACRLVSGLGLLGIGAFLLAQSKKRQAKPLE
NFTMKGLAAAVGVLGVARLADANFLKATAEKPKEQENTSTDHQFFSRR*

RE06652.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:54:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17826-PA 101 GF17826-PA 1..101 1..98 298 67.6 Plus
Dana\GF19109-PA 125 GF19109-PA 1..70 1..71 264 71.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:54:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22448-PA 102 GG22448-PA 1..102 1..98 451 84.3 Plus
Dere\GG17631-PA 94 GG17631-PA 1..94 1..98 197 47.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:54:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18103-PA 96 GH18103-PA 1..96 1..97 306 54.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG31360-PA 98 CG31360-PA 1..98 1..98 496 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:54:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24603-PA 96 GI24603-PA 1..96 1..97 325 60.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:54:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22124-PA 102 GL22124-PA 1..102 1..98 291 68.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:54:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16208-PA 102 GA16208-PA 1..102 1..98 297 70.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:54:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15258-PA 98 GM15258-PA 1..98 1..98 467 91.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:54:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15168-PA 98 GD15168-PA 1..98 1..98 467 91.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:54:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22666-PA 96 GJ22666-PA 1..96 1..97 332 62.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:54:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13494-PA 112 GK13494-PA 1..81 1..87 243 64.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:54:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25494-PA 102 GE25494-PA 1..102 1..98 443 84.3 Plus
Dyak\GE17536-PA 90 GE17536-PA 1..90 1..98 231 54.1 Plus