Clone RE06857 Report

Search the DGRC for RE06857

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:68
Well:57
Vector:pFlc-1
Associated Gene/TranscriptmRpL22-RA
Protein status:RE06857.pep: gold
Preliminary Size:640
Sequenced Size:968

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4742 2001-12-14 Blastp of sequenced clone
CG4742 2002-01-01 Sim4 clustering to Release 2
CG4742 2003-01-01 Sim4 clustering to Release 3
mRpL22 2008-04-29 Release 5.5 accounting
mRpL22 2008-08-15 Release 5.9 accounting
mRpL22 2008-12-18 5.12 accounting

Clone Sequence Records

RE06857.complete Sequence

968 bp (968 high quality bases) assembled on 2001-12-14

GenBank Submission: AY070969

> RE06857.complete
GCATACCTGCTGCCATTGGTCACACTGGCAGATTACGCGATTATTTTTTT
TACGGAAAGTCTGCGTTTTCCCTTCCGGATTGAATTGCCTGGATTTGCTG
TGATAACTCAAGCAAGCTAAGATGCACAAGGTGATCCGGCAAATGTCCCA
GCTGCGCCTGCAGGCGCCACAGGGAGCAGCGCTCCTCCGATCGGCGGATA
GCAGCTCAATATCACCAGCCATATCACCAGTTTCACCACCTGCCCTCCAG
TCGAAATCCCTGCACACGGCCGCTTCCGCCGGAATGCTGTGCGCCAAGTG
GAACAAGTACAACTACGGACCCCGCAAATGGCTGGAGTACAACAAGACCG
TGCATCCGCCGCAGGAAACGGACGAGGAGCCCAGAAATGCTTATGTCTGC
CACATGCGCAGCAACATCAAATACAGTCCGGACAAGATGTGGTACATCGC
TGCCTTTGTTCGCGGAATGTCCGTCGACGAGGCGCTGAAGCAGCTGAACT
TTGTGCTCAAAAAGGGGGCCACCGATGTGAAGGAGACCATACTGGAGGCC
CAGCAAATAGCCGTGGAGCGGCATAACGTGGAGTACAAGAGCAATCTGTG
GATAGCCGAATCCTTCGTGGGCAAGGGACGCGTCTTCAAGGGCGTGAGGC
GGCATGCTCGCGGTCGCTTCGGCAAAGTGGAGTACAAGCACTGCCACTAC
TTCGTGCGCCTGGAGGAGGGCGAGCCGCCGCAGCACTACTACCAGGAGCC
GCAGACGCCGGAGCAGCAGTACGAGAGCTGGATGGAGCAGATGCGAAGCC
GGAAGATCATCAACTCGCTGTAGCCACCTGAATTGGCACTCGTATGCAAT
CGATCCGCACTCCTGCAGTCCTCCATCGCCATCGCGTCCACGCGCATTAA
GCATTTTTTTTGGTTTTAGAAGATTGTTTAATAAAATAGAAACAGACAAA
AGAAAAAAAAAAAAAAAA

RE06857.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL22-RA 1059 mRpL22-RA 66..1019 1..954 4770 100 Plus
mRpL22.b 1072 mRpL22.b 5..609 1..605 3025 100 Plus
mRpL22.a 722 mRpL22.a 5..609 1..605 3025 100 Plus
mRpL22.b 1072 mRpL22.b 722..1072 604..954 1755 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:30:48
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16673588..16673978 1..391 1955 100 Plus
chrX 22417052 chrX 16674378..16674726 604..952 1745 100 Plus
chrX 22417052 chrX 16674052..16674265 392..605 1055 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:29:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:30:47
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16783954..16784344 1..391 1955 100 Plus
X 23542271 X 16784744..16785094 604..954 1755 100 Plus
X 23542271 X 16784418..16784631 392..605 1070 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:09
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 16792052..16792442 1..391 1955 100 Plus
X 23527363 X 16792842..16793192 604..954 1755 100 Plus
X 23527363 X 16792516..16792729 392..605 1070 100 Plus
Blast to na_te.dros performed on 2019-03-16 04:30:47 has no hits.

RE06857.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:31:47 Download gff for RE06857.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 16673588..16673978 1..391 100 -> Plus
chrX 16674052..16674265 392..605 99 -> Plus
chrX 16674380..16674726 606..952 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:50:08 Download gff for RE06857.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL22-RA 1..702 122..823 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:38 Download gff for RE06857.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL22-RA 1..702 122..823 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:31:46 Download gff for RE06857.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL22-RA 1..702 122..823 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:10 Download gff for RE06857.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL22-RA 1..702 122..823 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:41:36 Download gff for RE06857.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL22-RA 1..702 122..823 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:09:06 Download gff for RE06857.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL22-RA 1..952 1..952 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:38 Download gff for RE06857.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL22-RA 1..952 1..952 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:31:46 Download gff for RE06857.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL22-RA 22..973 1..952 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:11 Download gff for RE06857.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL22-RA 1..952 1..952 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:41:36 Download gff for RE06857.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL22-RA 22..973 1..952 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:31:47 Download gff for RE06857.complete
Subject Subject Range Query Range Percent Splice Strand
X 16783954..16784344 1..391 100 -> Plus
X 16784418..16784631 392..605 100 -> Plus
X 16784746..16785092 606..952 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:31:47 Download gff for RE06857.complete
Subject Subject Range Query Range Percent Splice Strand
X 16783954..16784344 1..391 100 -> Plus
X 16784418..16784631 392..605 100 -> Plus
X 16784746..16785092 606..952 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:31:47 Download gff for RE06857.complete
Subject Subject Range Query Range Percent Splice Strand
X 16783954..16784344 1..391 100 -> Plus
X 16784418..16784631 392..605 100 -> Plus
X 16784746..16785092 606..952 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:31:46 Download gff for RE06857.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16678451..16678664 392..605 100 -> Plus
arm_X 16677987..16678377 1..391 100 -> Plus
arm_X 16678779..16679125 606..952 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:21:10 Download gff for RE06857.complete
Subject Subject Range Query Range Percent Splice Strand
X 16792052..16792442 1..391 100 -> Plus
X 16792516..16792729 392..605 100 -> Plus
X 16792844..16793190 606..952 100   Plus

RE06857.hyp Sequence

Translation from 121 to 822

> RE06857.hyp
MHKVIRQMSQLRLQAPQGAALLRSADSSSISPAISPVSPPALQSKSLHTA
ASAGMLCAKWNKYNYGPRKWLEYNKTVHPPQETDEEPRNAYVCHMRSNIK
YSPDKMWYIAAFVRGMSVDEALKQLNFVLKKGATDVKETILEAQQIAVER
HNVEYKSNLWIAESFVGKGRVFKGVRRHARGRFGKVEYKHCHYFVRLEEG
EPPQHYYQEPQTPEQQYESWMEQMRSRKIINSL*

RE06857.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:45:26
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL22-PA 233 CG4742-PA 1..233 1..233 1239 100 Plus

RE06857.pep Sequence

Translation from 121 to 822

> RE06857.pep
MHKVIRQMSQLRLQAPQGAALLRSADSSSISPAISPVSPPALQSKSLHTA
ASAGMLCAKWNKYNYGPRKWLEYNKTVHPPQETDEEPRNAYVCHMRSNIK
YSPDKMWYIAAFVRGMSVDEALKQLNFVLKKGATDVKETILEAQQIAVER
HNVEYKSNLWIAESFVGKGRVFKGVRRHARGRFGKVEYKHCHYFVRLEEG
EPPQHYYQEPQTPEQQYESWMEQMRSRKIINSL*

RE06857.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:24:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22663-PA 232 GF22663-PA 1..232 1..233 986 83.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:24:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19077-PA 232 GG19077-PA 1..232 1..233 1189 94.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:24:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24048-PA 228 GH24048-PA 1..228 1..233 995 79.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:01
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL22-PA 233 CG4742-PA 1..233 1..233 1239 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:24:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15151-PA 231 GI15151-PA 1..231 1..233 986 79.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:24:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26864-PA 233 GL26864-PA 1..233 1..233 1000 80.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:24:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18397-PA 233 GA18397-PA 1..233 1..233 1001 81.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:24:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13465-PA 231 GM13465-PA 1..231 1..233 1218 97.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:24:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17306-PA 231 GD17306-PA 1..231 1..233 1214 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:24:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19341-PA 232 GJ19341-PA 1..232 1..233 935 77.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:24:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14752-PA 240 GK14752-PA 1..240 1..233 983 77.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:24:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17623-PA 232 GE17623-PA 1..232 1..233 1202 95.7 Plus