Clone RE06926 Report

Search the DGRC for RE06926

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:69
Well:26
Vector:pFlc-1
Associated Gene/TranscriptChrac-14-RB
Protein status:RE06926.pep: gold
Preliminary Size:570
Sequenced Size:602

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32956 2001-12-14 Blastp of sequenced clone
CG13399 2002-01-01 Sim4 clustering to Release 2
CG32956 2003-01-01 Sim4 clustering to Release 3
Chrac-14 2008-04-29 Release 5.5 accounting
Chrac-14 2008-08-15 Release 5.9 accounting
Chrac-14 2008-12-18 5.12 accounting

Clone Sequence Records

RE06926.complete Sequence

602 bp (602 high quality bases) assembled on 2001-12-14

GenBank Submission: AY070970

> RE06926.complete
AGCTGTTTACTCTTTACGCGGGAAGCAAAGACGCCGAAATCTAGACGGAA
AATCAAAAGTGCCCACCAAGTAAAAGCAGATAAGCAGCAGCAAAATGGTC
GAGCGCATCGAGGATCTTAACCTGCCGAATGCCGTGATTGGCCGGCTCAT
CAAGGAAGCACTGCCGGAGTCAGCTAGTGTCAGCAAGGAAGCGCGAGCAG
CGATCGCCCGAGCGGCATCTGTGTTTGCCATCTTCGTGACATCCTCGTCG
ACGGCGTTGGCCCACAAGCAGAACCACAAGACCATCACGGCCAAGGATAT
TCTACAGACCCTCACCGAGCTAGACTTCGAAAGCTTCGTGCCCTCTCTGA
CGCAGGATCTCGAGGTCTATCGTAAAGTGGTCAAGGAGAAAAAGGAGAGC
AAGGCCAGCAAGAAGGATTCCAACACTGCCGAAAATGCCAACGCCAGTGC
CACCGCAACAGCAGAGGAAGCCCCCGAGTGATTACGAATAGGAGAAACTA
TACGGATCAATTATCCTCTTCAGTCATTAAGAACAAAGCTAGTATTGAGC
ATTAACAAAAAACATTAAACATAGGCATTATCTAAGAAAAAAAAAAAAAA
AA

RE06926.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
Chrac-14-RA 4718 Chrac-14-RA 1..588 1..588 2940 100 Plus
mus201-RB 4718 mus201-RB 1..588 1..588 2940 100 Plus
Chrac-14-RB 588 Chrac-14-RB 1..588 1..588 2940 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:58:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8436332..8436917 1..586 2885 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:29:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:58:41
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8437411..8437998 1..588 2940 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8437411..8437998 1..588 2940 100 Plus
Blast to na_te.dros performed on 2019-03-16 03:58:42 has no hits.

RE06926.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:59:33 Download gff for RE06926.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8436332..8436917 1..586 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:50:12 Download gff for RE06926.complete
Subject Subject Range Query Range Percent Splice Strand
Chrac-14-RB 1..387 95..481 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:35 Download gff for RE06926.complete
Subject Subject Range Query Range Percent Splice Strand
Chrac-14-RB 1..387 95..481 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:10:36 Download gff for RE06926.complete
Subject Subject Range Query Range Percent Splice Strand
Chrac-14-RA 1..387 95..481 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:08 Download gff for RE06926.complete
Subject Subject Range Query Range Percent Splice Strand
Chrac-14-RB 1..387 95..481 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:21:21 Download gff for RE06926.complete
Subject Subject Range Query Range Percent Splice Strand
Chrac-14-RB 1..387 95..481 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:09:02 Download gff for RE06926.complete
Subject Subject Range Query Range Percent Splice Strand
Chrac-14-RB 1..586 1..586 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:35 Download gff for RE06926.complete
Subject Subject Range Query Range Percent Splice Strand
Chrac-14-RB 1..586 1..586 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:10:36 Download gff for RE06926.complete
Subject Subject Range Query Range Percent Splice Strand
mus201-RB 7..592 1..586 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:08 Download gff for RE06926.complete
Subject Subject Range Query Range Percent Splice Strand
Chrac-14-RB 1..586 1..586 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:21:21 Download gff for RE06926.complete
Subject Subject Range Query Range Percent Splice Strand
Chrac-14-RB 7..592 1..586 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:59:33 Download gff for RE06926.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8437411..8437996 1..586 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:59:33 Download gff for RE06926.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8437411..8437996 1..586 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:59:33 Download gff for RE06926.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8437411..8437996 1..586 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:10:36 Download gff for RE06926.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8437411..8437996 1..586 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:21:07 Download gff for RE06926.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8437411..8437996 1..586 100   Plus

RE06926.hyp Sequence

Translation from 94 to 480

> RE06926.hyp
MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS
SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKK
ESKASKKDSNTAENANASATATAEEAPE*

RE06926.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:13:17
Subject Length Description Subject Range Query Range Score Percent Strand
Chrac-14-PB 128 CG13399-PB 1..128 1..128 612 100 Plus

RE06926.pep Sequence

Translation from 94 to 480

> RE06926.pep
MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS
SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKK
ESKASKKDSNTAENANASATATAEEAPE*

RE06926.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:25:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15525-PA 126 GF15525-PA 1..126 1..128 487 83.6 Plus
Dana\GF14431-PA 150 GF14431-PA 32..150 4..125 140 28.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:25:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10552-PA 128 GG10552-PA 1..113 1..113 508 96.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:25:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10953-PA 135 GH10953-PA 1..114 1..113 483 82.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:14
Subject Length Description Subject Range Query Range Score Percent Strand
Chrac-14-PB 128 CG13399-PB 1..128 1..128 612 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:25:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10366-PA 132 GI10366-PA 1..114 1..113 456 85.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:25:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25950-PA 127 GL25950-PA 1..126 1..126 413 83.3 Plus
Dper\GL25948-PA 127 GL25948-PA 1..126 1..126 413 83.3 Plus
Dper\GL16633-PA 127 GL16633-PA 1..126 1..126 413 83.3 Plus
Dper\GL26173-PA 156 GL26173-PA 37..150 4..120 134 28.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:25:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17216-PA 127 GA17216-PA 1..126 1..126 413 83.3 Plus
Dpse\GA10323-PA 156 GA10323-PA 37..150 4..120 134 28.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:25:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16944-PA 129 GM16944-PA 1..93 1..93 431 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:25:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23542-PA 129 GD23542-PA 1..93 1..93 430 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:25:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18023-PA 130 GJ18023-PA 1..106 1..106 447 88.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:25:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18418-PA 131 GK18418-PA 1..123 1..123 459 80.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:25:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Chrac-14-PA 128 GE18772-PA 1..116 1..116 507 94 Plus