BDGP Sequence Production Resources |
Search the DGRC for RE06926
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 69 |
Well: | 26 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Chrac-14-RB |
Protein status: | RE06926.pep: gold |
Preliminary Size: | 570 |
Sequenced Size: | 602 |
Gene | Date | Evidence |
---|---|---|
CG32956 | 2001-12-14 | Blastp of sequenced clone |
CG13399 | 2002-01-01 | Sim4 clustering to Release 2 |
CG32956 | 2003-01-01 | Sim4 clustering to Release 3 |
Chrac-14 | 2008-04-29 | Release 5.5 accounting |
Chrac-14 | 2008-08-15 | Release 5.9 accounting |
Chrac-14 | 2008-12-18 | 5.12 accounting |
602 bp (602 high quality bases) assembled on 2001-12-14
GenBank Submission: AY070970
> RE06926.complete AGCTGTTTACTCTTTACGCGGGAAGCAAAGACGCCGAAATCTAGACGGAA AATCAAAAGTGCCCACCAAGTAAAAGCAGATAAGCAGCAGCAAAATGGTC GAGCGCATCGAGGATCTTAACCTGCCGAATGCCGTGATTGGCCGGCTCAT CAAGGAAGCACTGCCGGAGTCAGCTAGTGTCAGCAAGGAAGCGCGAGCAG CGATCGCCCGAGCGGCATCTGTGTTTGCCATCTTCGTGACATCCTCGTCG ACGGCGTTGGCCCACAAGCAGAACCACAAGACCATCACGGCCAAGGATAT TCTACAGACCCTCACCGAGCTAGACTTCGAAAGCTTCGTGCCCTCTCTGA CGCAGGATCTCGAGGTCTATCGTAAAGTGGTCAAGGAGAAAAAGGAGAGC AAGGCCAGCAAGAAGGATTCCAACACTGCCGAAAATGCCAACGCCAGTGC CACCGCAACAGCAGAGGAAGCCCCCGAGTGATTACGAATAGGAGAAACTA TACGGATCAATTATCCTCTTCAGTCATTAAGAACAAAGCTAGTATTGAGC ATTAACAAAAAACATTAAACATAGGCATTATCTAAGAAAAAAAAAAAAAA AA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 8436332..8436917 | 1..586 | 2885 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 8437411..8437998 | 1..588 | 2940 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 8437411..8437998 | 1..588 | 2940 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 8436332..8436917 | 1..586 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Chrac-14-RB | 1..387 | 95..481 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Chrac-14-RB | 1..387 | 95..481 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Chrac-14-RA | 1..387 | 95..481 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Chrac-14-RB | 1..387 | 95..481 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Chrac-14-RB | 1..387 | 95..481 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Chrac-14-RB | 1..586 | 1..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Chrac-14-RB | 1..586 | 1..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mus201-RB | 7..592 | 1..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Chrac-14-RB | 1..586 | 1..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Chrac-14-RB | 7..592 | 1..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8437411..8437996 | 1..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8437411..8437996 | 1..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8437411..8437996 | 1..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 8437411..8437996 | 1..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8437411..8437996 | 1..586 | 100 | Plus |
Translation from 94 to 480
> RE06926.hyp MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKK ESKASKKDSNTAENANASATATAEEAPE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Chrac-14-PB | 128 | CG13399-PB | 1..128 | 1..128 | 612 | 100 | Plus |
Translation from 94 to 480
> RE06926.pep MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKK ESKASKKDSNTAENANASATATAEEAPE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15525-PA | 126 | GF15525-PA | 1..126 | 1..128 | 487 | 83.6 | Plus |
Dana\GF14431-PA | 150 | GF14431-PA | 32..150 | 4..125 | 140 | 28.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10552-PA | 128 | GG10552-PA | 1..113 | 1..113 | 508 | 96.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10953-PA | 135 | GH10953-PA | 1..114 | 1..113 | 483 | 82.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Chrac-14-PB | 128 | CG13399-PB | 1..128 | 1..128 | 612 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10366-PA | 132 | GI10366-PA | 1..114 | 1..113 | 456 | 85.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25950-PA | 127 | GL25950-PA | 1..126 | 1..126 | 413 | 83.3 | Plus |
Dper\GL25948-PA | 127 | GL25948-PA | 1..126 | 1..126 | 413 | 83.3 | Plus |
Dper\GL16633-PA | 127 | GL16633-PA | 1..126 | 1..126 | 413 | 83.3 | Plus |
Dper\GL26173-PA | 156 | GL26173-PA | 37..150 | 4..120 | 134 | 28.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA17216-PA | 127 | GA17216-PA | 1..126 | 1..126 | 413 | 83.3 | Plus |
Dpse\GA10323-PA | 156 | GA10323-PA | 37..150 | 4..120 | 134 | 28.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16944-PA | 129 | GM16944-PA | 1..93 | 1..93 | 431 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23542-PA | 129 | GD23542-PA | 1..93 | 1..93 | 430 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ18023-PA | 130 | GJ18023-PA | 1..106 | 1..106 | 447 | 88.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK18418-PA | 131 | GK18418-PA | 1..123 | 1..123 | 459 | 80.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\Chrac-14-PA | 128 | GE18772-PA | 1..116 | 1..116 | 507 | 94 | Plus |