Clone RE06943 Report

Search the DGRC for RE06943

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:69
Well:43
Vector:pFlc-1
Associated Gene/TranscriptCG6951-RA
Protein status:RE06943.pep: gold
Sequenced Size:888

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6951 2003-01-01 Sim4 clustering to Release 3
CG6951 2004-01-14 Blastp of sequenced clone
CG6951 2008-04-29 Release 5.5 accounting
CG6951 2008-08-15 Release 5.9 accounting
CG6951 2008-12-18 5.12 accounting

Clone Sequence Records

RE06943.complete Sequence

888 bp (888 high quality bases) assembled on 2004-01-14

GenBank Submission: BT011479

> RE06943.complete
ATTGTTTGTTTTGCCGTCGTCCTCGCATTTCGTCTTTGTTAATTTCCTCA
AAAAGTATACTGCGTCTTGTGTTCTTCGTGGCATAGAAATGGCTGAAGTT
TCCGCTCAAGATTTGATATCCCAGTTGTCGAAGTCACCCGAAAGCCACAA
GAGAAAGGAATATCTGCATTGGGATGACTACTTTATGGCCACCTCACTGC
TCTCCGCCAAACGCAGCAAAGATCCCGTCACCCAAGTGGGCGCCTGCATC
GTGGATTCCCAGAATCGGATAGTGGCCATTGGATACAATGGGTTCCCTCG
CAACTGCAGCGATGACGTGTTTCCGTGGTCAAAAGCTAAGAAAGGCTCGC
AGGAATTTGATCCCCTGGAAGACAAGAAGATGTACGTGGTCCACGCGGAG
GCCAATGCAATCCTGAACAGCAACGGCATGAGTTTGTCTGGAACTCGACT
GTATACCACACTATTTCCGTGCAACGAATGTGCCAAACTCATTATACAGG
TGGGCATATCTCAGGTGCTATATTTGTCCGACAAATATGCCGATAAGCCC
ACATATCGTGCATCCAAGCGGATGCTGGATGCAGTGGGCGTGGAATATAA
GCGACACATCCCCCAGAAAAAAACGATCACCATTGATTTTGACACCTTCC
CGGAAGAAGATCCGAATGCATCCCTGGGACTAAACGAACTCCATTTGTAA
TGTACTAATACAATCTTAGCTATCTTGACAACTTTTAATGTGTTTAAAGT
AAATTTGACGTGATCGGACTAAATATGTAGACAAATGATAAATAAATTTA
ATAGCATGCTAATTAAGTTATACTTAGTTTGGCAGTACTAATATAAATAA
AAAAATACAGTTTAACTAAAAAGCAAAAAAAAAAAAAA

RE06943.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG6951.a 1105 CG6951.a 45..922 1..878 4390 100 Plus
CG6951-RA 921 CG6951-RA 45..921 1..877 4385 100 Plus
CG6951.b 1245 CG6951.b 269..1062 85..878 3970 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:46:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20233336..20233752 85..501 2070 99.8 Plus
chr3L 24539361 chr3L 20234108..20234485 497..874 1890 100 Plus
chr3L 24539361 chr3L 20230770..20230855 1..86 430 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:29:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:46:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20244163..20244579 85..501 2085 100 Plus
3L 28110227 3L 20244935..20245316 497..878 1910 100 Plus
3L 28110227 3L 20241599..20241684 1..86 430 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:53:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20237263..20237679 85..501 2085 100 Plus
3L 28103327 3L 20238035..20238416 497..878 1910 100 Plus
3L 28103327 3L 20234699..20234784 1..86 430 100 Plus
Blast to na_te.dros performed on 2019-03-16 14:46:58 has no hits.

RE06943.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:47:33 Download gff for RE06943.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20230770..20230855 1..86 100 -> Plus
chr3L 20233338..20233750 87..499 99 -> Plus
chr3L 20234111..20234485 500..874 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:50:14 Download gff for RE06943.complete
Subject Subject Range Query Range Percent Splice Strand
CG6951-RA 1..612 89..700 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:42:21 Download gff for RE06943.complete
Subject Subject Range Query Range Percent Splice Strand
CG6951-RA 1..612 89..700 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:29:33 Download gff for RE06943.complete
Subject Subject Range Query Range Percent Splice Strand
CG6951-RB 1..612 89..700 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:31:11 Download gff for RE06943.complete
Subject Subject Range Query Range Percent Splice Strand
CG6951-RA 1..612 89..700 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:35:23 Download gff for RE06943.complete
Subject Subject Range Query Range Percent Splice Strand
CG6951-RB 1..612 89..700 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:52:03 Download gff for RE06943.complete
Subject Subject Range Query Range Percent Splice Strand
CG6951-RA 1..700 1..700 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:42:20 Download gff for RE06943.complete
Subject Subject Range Query Range Percent Splice Strand
CG6951-RA 33..906 1..874 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:29:33 Download gff for RE06943.complete
Subject Subject Range Query Range Percent Splice Strand
CG6951-RA 37..910 1..874 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:31:11 Download gff for RE06943.complete
Subject Subject Range Query Range Percent Splice Strand
CG6951-RA 1..700 1..700 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:35:23 Download gff for RE06943.complete
Subject Subject Range Query Range Percent Splice Strand
CG6951-RA 37..910 1..874 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:33 Download gff for RE06943.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20241599..20241684 1..86 100 -> Plus
3L 20244165..20244577 87..499 100 -> Plus
3L 20244938..20245312 500..874 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:33 Download gff for RE06943.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20241599..20241684 1..86 100 -> Plus
3L 20244165..20244577 87..499 100 -> Plus
3L 20244938..20245312 500..874 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:33 Download gff for RE06943.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20241599..20241684 1..86 100 -> Plus
3L 20244165..20244577 87..499 100 -> Plus
3L 20244938..20245312 500..874 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:29:33 Download gff for RE06943.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20234699..20234784 1..86 100 -> Plus
arm_3L 20237265..20237677 87..499 100 -> Plus
arm_3L 20238038..20238412 500..874 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:03:43 Download gff for RE06943.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20237265..20237677 87..499 100 -> Plus
3L 20238038..20238412 500..874 100   Plus
3L 20234699..20234784 1..86 100 -> Plus

RE06943.hyp Sequence

Translation from 0 to 699

> RE06943.hyp
LFVLPSSSHFVFVNFLKKYTASCVLRGIEMAEVSAQDLISQLSKSPESHK
RKEYLHWDDYFMATSLLSAKRSKDPVTQVGACIVDSQNRIVAIGYNGFPR
NCSDDVFPWSKAKKGSQEFDPLEDKKMYVVHAEANAILNSNGMSLSGTRL
YTTLFPCNECAKLIIQVGISQVLYLSDKYADKPTYRASKRMLDAVGVEYK
RHIPQKKTITIDFDTFPEEDPNASLGLNELHL*

RE06943.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:36:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG6951-PA 203 CG6951-PA 1..203 30..232 1061 100 Plus
CG6951-PB 203 CG6951-PB 1..203 30..232 1061 100 Plus

RE06943.pep Sequence

Translation from 88 to 699

> RE06943.pep
MAEVSAQDLISQLSKSPESHKRKEYLHWDDYFMATSLLSAKRSKDPVTQV
GACIVDSQNRIVAIGYNGFPRNCSDDVFPWSKAKKGSQEFDPLEDKKMYV
VHAEANAILNSNGMSLSGTRLYTTLFPCNECAKLIIQVGISQVLYLSDKY
ADKPTYRASKRMLDAVGVEYKRHIPQKKTITIDFDTFPEEDPNASLGLNE
LHL*

RE06943.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:24:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25318-PA 187 GF25318-PA 2..187 18..203 856 81.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:24:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16092-PA 199 GG16092-PA 2..194 6..197 916 87.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:24:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15113-PA 194 GH15113-PA 25..193 20..192 699 71.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG6951-PA 203 CG6951-PA 1..203 1..203 1061 100 Plus
CG6951-PB 203 CG6951-PB 1..203 1..203 1061 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:24:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13764-PA 189 GI13764-PA 21..186 16..185 662 70 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:24:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25124-PA 159 GL25124-PA 1..158 33..191 630 75.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:25:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19978-PA 159 GA19978-PA 1..158 33..191 631 75.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:25:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22266-PA 191 GM22266-PA 1..191 1..191 935 90.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:25:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14864-PA 187 GD14864-PA 1..185 1..185 874 88.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:25:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13755-PA 193 GJ13755-PA 12..191 6..190 692 70.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:25:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17242-PA 203 GK17242-PA 39..201 18..185 657 72 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:25:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19654-PA 199 GE19654-PA 2..199 6..203 993 90.9 Plus