Clone RE07220 Report

Search the DGRC for RE07220

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:72
Well:20
Vector:pFlc-1
Associated Gene/TranscriptMlc1-RB
Protein status:RE07220.pep: gold
Sequenced Size:851

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5596 2001-12-14 Blastp of sequenced clone
CG5596 2002-01-01 Sim4 clustering to Release 2
CG5596 2003-01-01 Sim4 clustering to Release 3
Mlc1 2008-04-29 Release 5.5 accounting
Mlc1 2008-08-15 Release 5.9 accounting
Mlc1 2008-12-18 5.12 accounting

Clone Sequence Records

RE07220.complete Sequence

851 bp (851 high quality bases) assembled on 2001-12-14

GenBank Submission: AY070972

> RE07220.complete
GCCGTACTGCCACTGACGAATAACGTTCAGTCGAGACCGAGCTCATCCGC
GATACAGTTGATTTTCGCATCAAACAGACAAAATGGCTGATGTTCCAAAG
CGTGAAGTTGAAAATGTCGAATTCGTTTTCGAAGTCATGGGCTCCCCCGG
TGAGGGCATTGATGCCGTCGACCTAGGTGATGCCCTCCGCGCTCTGAACT
TGAACCCCACATTGGCGCTGATCGAGAAATTGGGCGGCACCAAGAAGCGC
AACGAGAAGAAGATCAAGCTGGATGAGTTCCTGCCCATCTACTCACAGGT
CAAGAAGGAGAAGGAGCAGGGCTGCTACGAGGACTTCATTGAGTGCTTGA
AGCTCTACGACAAGGAGGAGAACGGCACCATGCTGCTGGCTGAGCTGCAG
CACGCCCTGCTGGCGCTTGGTGAGAGCTTGGATGACGAGCAGGTGGAGAC
CCTGTTCGCTGACTGCATGGATCCCGAGGATGATGAAGGATTTATCCCCT
ACTCTCAGTTCGTCCAGCGCCTGATGAGCGATCCTGTCGTCTTCGACTAA
ACACATTCCTAGCCAGAATGTGTGACAGACCAGATCAGCTAAAATAGTTG
AAAACAACAGCTTCAACAACAACCAACAAACAACAACAACAACAACAACA
ACACCAACAAACTTTTAGCGACAACCATTCTCCATAGATGTTATATTCAT
CGCTAACTCTCTCTATCTCTCTCGTATATTATTTTAATTAAAAATTACTT
CTGCTACTACAACTGCAAAATTGAACTTCAAGATAATATTATTTTTTAAA
AAATAAAAAAATTTAAATTATAAAATAACGAAAACAAAAAAAAAAAAAAA
A

RE07220.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:04:50
Subject Length Description Subject Range Query Range Score Percent Strand
Mlc1.h 1728 Mlc1.h 438..1279 1..842 4180 99.7 Plus
Mlc1.d 1505 Mlc1.d 215..1056 1..842 4180 99.7 Plus
Mlc1-RB 1728 Mlc1-RB 438..1279 1..842 4180 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:17:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 23481516..23481826 424..114 1540 99.7 Minus
chr3R 27901430 chr3R 23480584..23480865 835..554 1395 99.6 Minus
chr3R 27901430 chr3R 23481374..23481461 506..419 440 100 Minus
chr3R 27901430 chr3R 23483020..23483105 86..1 430 100 Minus
chr3R 27901430 chr3R 23480977..23481023 553..507 235 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:29:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:17:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27658611..27658921 424..114 1540 99.7 Minus
3R 32079331 3R 27657667..27657955 842..554 1430 99.7 Minus
3R 32079331 3R 27658469..27658556 506..419 440 100 Minus
3R 32079331 3R 27660109..27660194 86..1 430 100 Minus
3R 32079331 3R 27658067..27658113 553..507 235 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 27399442..27399752 424..114 1540 99.6 Minus
3R 31820162 3R 27398498..27398786 842..554 1430 99.6 Minus
3R 31820162 3R 27399300..27399387 506..419 440 100 Minus
3R 31820162 3R 27400940..27401025 86..1 430 100 Minus
3R 31820162 3R 27398898..27398944 553..507 235 100 Minus
3R 31820162 3R 27400760..27400788 113..85 145 100 Minus
Blast to na_te.dros performed 2019-03-16 18:17:53
Subject Length Description Subject Range Query Range Score Percent Strand
blood 7410 blood BLOOD 7410bp 6887..6957 826..755 132 66.7 Minus

RE07220.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:18:47 Download gff for RE07220.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 23480817..23480865 554..602 97 <- Minus
chr3R 23480977..23481023 507..553 100 <- Minus
chr3R 23481374..23481460 420..506 100 <- Minus
chr3R 23481521..23481826 114..419 99 <- Minus
chr3R 23482840..23482867 86..113 100 <- Minus
chr3R 23483021..23483105 1..85 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:50:21 Download gff for RE07220.complete
Subject Subject Range Query Range Percent Splice Strand
Mlc1-RB 1..468 83..550 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:40:08 Download gff for RE07220.complete
Subject Subject Range Query Range Percent Splice Strand
Mlc1-RB 1..468 83..550 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:12:44 Download gff for RE07220.complete
Subject Subject Range Query Range Percent Splice Strand
Mlc1-RB 1..468 83..550 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:09:03 Download gff for RE07220.complete
Subject Subject Range Query Range Percent Splice Strand
Mlc1-RB 1..468 83..550 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:37:27 Download gff for RE07220.complete
Subject Subject Range Query Range Percent Splice Strand
Mlc1-RB 1..468 83..550 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:21:41 Download gff for RE07220.complete
Subject Subject Range Query Range Percent Splice Strand
Mlc1-RB 6..840 1..835 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:40:08 Download gff for RE07220.complete
Subject Subject Range Query Range Percent Splice Strand
Mlc1-RB 6..840 1..835 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:12:44 Download gff for RE07220.complete
Subject Subject Range Query Range Percent Splice Strand
Mlc1-RB 1..818 18..835 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:09:03 Download gff for RE07220.complete
Subject Subject Range Query Range Percent Splice Strand
Mlc1-RB 6..840 1..835 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:37:27 Download gff for RE07220.complete
Subject Subject Range Query Range Percent Splice Strand
Mlc1-RB 1..818 18..835 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:18:47 Download gff for RE07220.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27657674..27657955 554..835 99 <- Minus
3R 27658067..27658113 507..553 100 <- Minus
3R 27658469..27658555 420..506 100 <- Minus
3R 27658616..27658921 114..419 99 <- Minus
3R 27659929..27659956 86..113 100 <- Minus
3R 27660110..27660194 1..85 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:18:47 Download gff for RE07220.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27657674..27657955 554..835 99 <- Minus
3R 27658067..27658113 507..553 100 <- Minus
3R 27658469..27658555 420..506 100 <- Minus
3R 27658616..27658921 114..419 99 <- Minus
3R 27659929..27659956 86..113 100 <- Minus
3R 27660110..27660194 1..85 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:18:47 Download gff for RE07220.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27657674..27657955 554..835 99 <- Minus
3R 27658067..27658113 507..553 100 <- Minus
3R 27658469..27658555 420..506 100 <- Minus
3R 27658616..27658921 114..419 99 <- Minus
3R 27659929..27659956 86..113 100 <- Minus
3R 27660110..27660194 1..85 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:12:44 Download gff for RE07220.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23483396..23483677 554..835 99 <- Minus
arm_3R 23483789..23483835 507..553 100 <- Minus
arm_3R 23484191..23484277 420..506 100 <- Minus
arm_3R 23484338..23484643 114..419 99 <- Minus
arm_3R 23485651..23485678 86..113 100 <- Minus
arm_3R 23485832..23485916 1..85 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:45:12 Download gff for RE07220.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27398505..27398786 554..835 99 <- Minus
3R 27398898..27398944 507..553 100 <- Minus
3R 27399300..27399386 420..506 100 <- Minus
3R 27399447..27399752 114..419 99 <- Minus
3R 27400760..27400787 86..113 100 <- Minus
3R 27400941..27401025 1..85 100   Minus

RE07220.pep Sequence

Translation from 82 to 549

> RE07220.pep
MADVPKREVENVEFVFEVMGSPGEGIDAVDLGDALRALNLNPTLALIEKL
GGTKKRNEKKIKLDEFLPIYSQVKKEKEQGCYEDFIECLKLYDKEENGTM
LLAELQHALLALGESLDDEQVETLFADCMDPEDDEGFIPYSQFVQRLMSD
PVVFD*

RE07220.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:38:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18698-PA 155 GF18698-PA 1..155 1..155 787 96.1 Plus
Dana\GF21286-PA 147 GF21286-PA 1..146 1..149 218 37.3 Plus
Dana\GF12835-PA 149 GF12835-PA 1..148 1..149 140 29.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:38:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12101-PA 155 GG12101-PA 1..155 1..155 797 99.4 Plus
Dere\GG18489-PA 147 GG18489-PA 1..146 1..149 218 37.3 Plus
Dere\GG20265-PA 149 GG20265-PA 1..148 1..149 140 29.6 Plus
Dere\GG24532-PA 193 GG24532-PA 64..191 26..148 136 29 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:38:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21626-PA 155 GH21626-PA 1..155 1..155 765 94.8 Plus
Dgri\GH19638-PA 89 GH19638-PA 1..89 67..155 436 93.3 Plus
Dgri\GH24922-PA 158 GH24922-PA 26..157 15..149 213 39.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:40
Subject Length Description Subject Range Query Range Score Percent Strand
Mlc1-PD 155 CG5596-PD 1..155 1..155 799 100 Plus
Mlc1-PB 155 CG5596-PB 1..155 1..155 799 100 Plus
Mlc1-PA 155 CG5596-PA 1..151 1..151 744 95.4 Plus
Mlc-c-PA 147 CG3201-PA 1..146 1..149 226 37.3 Plus
Mlc-c-PB 153 CG3201-PB 15..152 9..149 226 38.7 Plus
Cam-PD 149 CG8472-PD 1..148 1..149 157 29.6 Plus
Cam-PC 149 CG8472-PC 1..148 1..149 157 29.6 Plus
Cam-PE 149 CG8472-PE 1..148 1..149 157 29.6 Plus
Cam-PB 149 CG8472-PB 1..148 1..149 157 29.6 Plus
Cam-PA 149 CG8472-PA 1..148 1..149 157 29.6 Plus
Acam-PB 148 CG17769-PB 1..142 1..144 143 26.7 Plus
Acam-PA 148 CG17769-PA 1..142 1..144 143 26.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:38:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10745-PA 154 GI10745-PA 1..154 2..155 780 97.4 Plus
Dmoj\GI21775-PA 153 GI21775-PA 15..152 9..149 217 38.7 Plus
Dmoj\GI20594-PA 149 GI20594-PA 1..148 1..149 140 29.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:38:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13770-PA 155 GL13770-PA 1..155 1..155 780 95.5 Plus
Dper\GL16470-PA 153 GL16470-PA 15..152 9..149 222 39.4 Plus
Dper\GL10814-PA 149 GL10814-PA 1..148 1..149 140 29.6 Plus
Dper\GL11703-PA 149 GL11703-PA 10..147 8..147 137 28.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:38:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Mlc1-PA 155 GA18996-PA 1..155 1..155 780 95.5 Plus
Dpse\Mlc1-PB 155 GA18996-PB 1..151 1..151 723 91.4 Plus
Dpse\GA22593-PA 153 GA22593-PA 15..152 9..149 222 39.4 Plus
Dpse\GA24499-PA 149 GA24499-PA 1..148 1..149 140 29.6 Plus
Dpse\GA24239-PA 149 GA24239-PA 10..149 8..149 135 28.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:38:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\Mlc1-PA 155 GM16330-PA 1..155 1..155 797 99.4 Plus
Dsec\GM12637-PA 147 GM12637-PA 1..146 1..149 218 37.3 Plus
Dsec\GM21351-PA 149 GM21351-PA 1..148 1..149 140 29.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:38:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Mlc1-PA 155 GD18066-PA 1..155 1..155 797 99.4 Plus
Dsim\GD16253-PA 147 GD16253-PA 1..146 1..149 218 37.3 Plus
Dsim\GD10849-PA 149 GD10849-PA 1..148 1..149 140 29.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:38:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Mlc1-PA 154 GJ10688-PA 1..154 2..155 779 97.4 Plus
Dvir\GJ16948-PA 146 GJ16948-PA 14..145 15..149 215 39.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:38:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11324-PA 155 GK11324-PA 1..155 1..155 786 96.8 Plus
Dwil\GK24961-PA 619 GK24961-PA 472..618 2..149 229 40.4 Plus
Dwil\GK14989-PA 174 GK14989-PA 27..173 8..149 144 27.2 Plus
Dwil\GK22183-PA 149 GK22183-PA 1..148 1..149 140 29.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:38:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Mlc1-PA 155 GE10549-PA 1..155 1..155 795 99.4 Plus
Dyak\GE16807-PA 147 GE16807-PA 1..146 1..149 218 37.3 Plus
Dyak\Cam-PA 149 GE12425-PA 1..148 1..149 140 29.6 Plus

RE07220.hyp Sequence

Translation from 82 to 549

> RE07220.hyp
MADVPKREVENVEFVFEVMGSPGEGIDAVDLGDALRALNLNPTLALIEKL
GGTKKRNEKKIKLDEFLPIYSQVKKEKEQGCYEDFIECLKLYDKEENGTM
LLAELQHALLALGESLDDEQVETLFADCMDPEDDEGFIPYSQFVQRLMSD
PVVFD*

RE07220.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:50:10
Subject Length Description Subject Range Query Range Score Percent Strand
Mlc1-PD 155 CG5596-PD 1..155 1..155 799 100 Plus
Mlc1-PB 155 CG5596-PB 1..155 1..155 799 100 Plus
Mlc1-PA 155 CG5596-PA 1..151 1..151 744 95.4 Plus
Mlc-c-PA 147 CG3201-PA 1..146 1..149 226 37.3 Plus
Mlc-c-PB 153 CG3201-PB 15..152 9..149 226 38.7 Plus