Clone RE07451 Report

Search the DGRC for RE07451

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:74
Well:51
Vector:pFlc-1
Associated Gene/TranscriptCypl-RA
Protein status:RE07451.pep: gold
Preliminary Size:531
Sequenced Size:719

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13892 2001-12-14 Blastp of sequenced clone
CG13892 2002-01-01 Sim4 clustering to Release 2
CG13892 2003-01-01 Sim4 clustering to Release 3
Cypl 2008-04-29 Release 5.5 accounting
Cypl 2008-08-15 Release 5.9 accounting
Cypl 2008-12-18 5.12 accounting

Clone Sequence Records

RE07451.complete Sequence

719 bp (719 high quality bases) assembled on 2001-12-14

GenBank Submission: AY070975

> RE07451.complete
AGTCTGACTCTGCCGGTTTTAACAATTTTACTGAAGTCTCGCTAATTTAA
CAACAAATATAGTTATGCTGTCCCTAAGCGATCCCAACAATGCTGGTGGC
ATTCCCGACAAGGCGTGGCAGCCGCACTTCGTGACCCTGGAAACGAGCAT
GGGAGAAATCACCGTGGAGCTGTACTGGAAACACGCGCCCAACACCTGCC
GCAACTTTGCCGAACTCTCGAGAAGGGGCTACTACAACAACGTGGTGTTC
CACCGGATCATCAGGGACTTCATGATCCAGGGCGGCGATCCCACGGGCAC
TGGCCGCGGAGGCGCCTCCATCTACGGATCGGAGTTCGCGGACGAGCTGC
ACGGCGACTTGAGGCACACGGGCGCGGGCATCCTCTCGATGGCCAACTCT
GGACCGGACACCAACGGGTCCCAGTTCTTCATCACGCTGGCGCCCACGCA
GTGGCTGGATGGCAAGCACACGATCTTCGGCAGGGTCTACACGGGCATGG
AGGTGGTCAAGCGGATCGGCATGGTGGAAACCGACAAGAACGATCGCCCC
GTGGATCCCCTAAGGATCATCAAGGCCAAGGTGGAGAAGCTGTGAGCCAA
GGAGGTGGATTTTTTGGAGGAACTGCTAGAATAAGTACGATTTAAACAAG
CGAAAGGTATCTTTCCATATGGATTTTATAACACTGATTATATGTATTTA
CGTAAAAAAAAAAAAAAAA

RE07451.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:39:33
Subject Length Description Subject Range Query Range Score Percent Strand
Cypl-RA 837 Cypl-RA 56..755 3..702 3500 100 Plus
nc_8670.a 622 nc_8670.a 156..194 247..285 165 94.8 Plus
CG2852.a 941 CG2852.a 358..396 247..285 165 94.8 Plus
nc_8670.a 622 nc_8670.a 298..344 389..435 145 87.2 Plus
CG2852.a 941 CG2852.a 500..546 389..435 145 87.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:20:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 541979..542535 702..146 2785 100 Minus
chr3L 24539361 chr3L 542624..542768 147..3 725 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:30:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:20:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 542123..542679 702..146 2785 100 Minus
3L 28110227 3L 542770..542914 147..3 725 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:06:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 542123..542679 702..146 2785 100 Minus
3L 28103327 3L 542770..542914 147..3 725 100 Minus
2R 25260384 2R 22646680..22646718 285..247 165 94.8 Minus
2R 25260384 2R 22646530..22646576 435..389 145 87.2 Minus
Blast to na_te.dros performed on 2019-03-16 09:20:25 has no hits.

RE07451.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:21:20 Download gff for RE07451.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 542624..542770 1..147 99   Minus
chr3L 541978..542533 148..703 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:50:30 Download gff for RE07451.complete
Subject Subject Range Query Range Percent Splice Strand
Cypl-RA 1..531 65..595 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:03:54 Download gff for RE07451.complete
Subject Subject Range Query Range Percent Splice Strand
Cypl-RA 1..531 65..595 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:00:08 Download gff for RE07451.complete
Subject Subject Range Query Range Percent Splice Strand
Cypl-RA 1..531 65..595 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:28:31 Download gff for RE07451.complete
Subject Subject Range Query Range Percent Splice Strand
Cypl-RA 1..531 65..595 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:07:32 Download gff for RE07451.complete
Subject Subject Range Query Range Percent Splice Strand
Cypl-RA 1..531 65..595 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:31:12 Download gff for RE07451.complete
Subject Subject Range Query Range Percent Splice Strand
Cypl-RA 1..702 1..703 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:03:54 Download gff for RE07451.complete
Subject Subject Range Query Range Percent Splice Strand
Cypl-RA 1..702 1..703 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:00:08 Download gff for RE07451.complete
Subject Subject Range Query Range Percent Splice Strand
Cypl-RA 16..717 1..703 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:28:31 Download gff for RE07451.complete
Subject Subject Range Query Range Percent Splice Strand
Cypl-RA 1..702 1..703 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:07:32 Download gff for RE07451.complete
Subject Subject Range Query Range Percent Splice Strand
Cypl-RA 16..717 1..703 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:21:20 Download gff for RE07451.complete
Subject Subject Range Query Range Percent Splice Strand
3L 542122..542677 148..703 99 <- Minus
3L 542770..542916 1..147 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:21:20 Download gff for RE07451.complete
Subject Subject Range Query Range Percent Splice Strand
3L 542122..542677 148..703 99 <- Minus
3L 542770..542916 1..147 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:21:20 Download gff for RE07451.complete
Subject Subject Range Query Range Percent Splice Strand
3L 542122..542677 148..703 99 <- Minus
3L 542770..542916 1..147 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:00:08 Download gff for RE07451.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 542122..542677 148..703 99 <- Minus
arm_3L 542770..542916 1..147 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:04:27 Download gff for RE07451.complete
Subject Subject Range Query Range Percent Splice Strand
3L 542122..542677 148..703 99 <- Minus
3L 542770..542916 1..147 99   Minus

RE07451.pep Sequence

Translation from 64 to 594

> RE07451.pep
MLSLSDPNNAGGIPDKAWQPHFVTLETSMGEITVELYWKHAPNTCRNFAE
LSRRGYYNNVVFHRIIRDFMIQGGDPTGTGRGGASIYGSEFADELHGDLR
HTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVVKR
IGMVETDKNDRPVDPLRIIKAKVEKL*

RE07451.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:29:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25039-PA 175 GF25039-PA 1..175 1..176 895 95.5 Plus
Dana\GF11272-PA 517 GF11272-PA 281..432 22..173 446 51.3 Plus
Dana\GF25290-PA 496 GF25290-PA 15..166 23..173 388 47.1 Plus
Dana\GF13630-PA 639 GF13630-PA 486..633 23..169 381 54.1 Plus
Dana\GF13003-PA 205 GF13003-PA 43..184 30..168 363 53.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:29:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14657-PA 176 GG14657-PA 1..176 1..176 925 97.7 Plus
Dere\GG22278-PA 517 GG22278-PA 281..432 22..173 443 50.7 Plus
Dere\GG15530-PA 502 GG15530-PA 15..166 23..173 388 47.1 Plus
Dere\GG22984-PA 637 GG22984-PA 484..631 23..169 372 54.1 Plus
Dere\GG21776-PA 205 GG21776-PA 43..184 30..168 360 53.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:29:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21768-PA 173 GH21768-PA 7..173 10..176 853 92.8 Plus
Dgri\GH19751-PA 513 GH19751-PA 280..431 22..173 459 54.6 Plus
Dgri\GH15083-PA 499 GH15083-PA 15..166 23..173 382 47.7 Plus
Dgri\GH20004-PA 637 GH20004-PA 484..631 23..169 368 52.7 Plus
Dgri\GH20332-PA 205 GH20332-PA 43..184 30..168 363 53.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:44
Subject Length Description Subject Range Query Range Score Percent Strand
Cypl-PA 176 CG13892-PA 1..176 1..176 943 100 Plus
CG7747-PA 517 CG7747-PA 281..432 22..173 435 50.7 Plus
CG3511-PB 637 CG3511-PB 484..631 23..169 425 54.1 Plus
CG3511-PA 637 CG3511-PA 484..631 23..169 425 54.1 Plus
CG10907-PA 502 CG10907-PA 15..166 23..173 379 46.4 Plus
CG2852-PD 205 CG2852-PD 43..179 30..163 358 55.1 Plus
CG2852-PA 205 CG2852-PA 43..179 30..163 358 55.1 Plus
CG11777-PA 161 CG11777-PA 3..143 23..162 319 44.7 Plus
CG7768-PB 164 CG7768-PB 17..142 29..151 312 51.2 Plus
CG7768-PA 164 CG7768-PA 17..142 29..151 312 51.2 Plus
Cyp1-PA 227 CG9916-PA 80..205 29..151 312 52 Plus
CG17266-PB 183 CG17266-PB 28..177 27..168 311 45 Plus
CG17266-PA 183 CG17266-PA 28..177 27..168 311 45 Plus
ninaA-PA 237 CG3966-PA 40..185 29..168 311 45.9 Plus
Moca-cyp-PA 970 CG1866-PA 26..192 29..175 297 41.7 Plus
cyp33-PA 300 CG4886-PA 153..277 30..151 282 50 Plus
CG5808-PA 653 CG5808-PA 3..156 23..168 278 39 Plus
CG8336-PD 383 CG8336-PD 29..177 30..168 199 36.4 Plus
CG8336-PC 383 CG8336-PC 29..177 30..168 199 36.4 Plus
CG8336-PA 383 CG8336-PA 29..177 30..168 199 36.4 Plus
CG8336-PB 383 CG8336-PB 29..177 30..168 199 36.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:29:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22699-PA 173 GI22699-PA 2..173 4..176 839 89.6 Plus
Dmoj\GI20287-PA 517 GI20287-PA 280..431 22..173 449 53.9 Plus
Dmoj\GI13730-PA 507 GI13730-PA 15..166 23..173 382 47.7 Plus
Dmoj\GI19185-PA 643 GI19185-PA 490..637 23..169 370 53.4 Plus
Dmoj\moj29-PA 205 GI20003-PA 16..184 2..168 368 48 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:29:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22598-PA 175 GL22598-PA 1..175 1..176 887 94.3 Plus
Dper\GL11352-PA 517 GL11352-PA 274..432 15..173 454 51.6 Plus
Dper\GL20720-PA 503 GL20720-PA 15..166 23..173 384 47.1 Plus
Dper\GL10223-PA 636 GL10223-PA 483..630 23..169 369 52.7 Plus
Dper\GL17482-PA 205 GL17482-PA 43..184 30..168 359 53.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:29:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12606-PA 175 GA12606-PA 1..175 1..176 887 94.3 Plus
Dpse\GA20560-PA 517 GA20560-PA 274..432 15..173 453 51.6 Plus
Dpse\GA10630-PA 503 GA10630-PA 15..166 23..173 385 47.1 Plus
Dpse\GA17492-PA 636 GA17492-PA 483..630 23..169 368 52.7 Plus
Dpse\GA15486-PA 205 GA15486-PA 43..184 30..168 359 53.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14273-PA 176 GM14273-PA 1..176 1..176 939 99.4 Plus
Dsec\GM20066-PA 517 GM20066-PA 281..432 22..173 443 50.7 Plus
Dsec\GM25298-PA 502 GM25298-PA 15..166 23..173 388 47.1 Plus
Dsec\GM11877-PA 637 GM11877-PA 484..631 23..169 371 54.1 Plus
Dsec\GM15627-PA 205 GM15627-PA 43..184 30..168 362 53.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25702-PA 176 GD25702-PA 1..176 1..176 939 99.4 Plus
Dsim\GD14329-PA 502 GD14329-PA 15..166 23..173 388 47.1 Plus
Dsim\GD11875-PA 637 GD11875-PA 484..631 23..169 371 54.1 Plus
Dsim\GD25116-PA 203 GD25116-PA 41..182 30..168 362 53.8 Plus
Dsim\GD10743-PA 161 GD10743-PA 3..143 23..162 330 44.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:29:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23427-PA 173 GJ23427-PA 2..173 4..176 848 90.8 Plus
Dvir\GJ15535-PA 281 GJ15535-PA 44..195 22..173 454 53.9 Plus
Dvir\GJ22016-PA 517 GJ22016-PA 280..431 22..173 453 53.9 Plus
Dvir\GJ14076-PA 498 GJ14076-PA 15..166 23..173 383 47.1 Plus
Dvir\GJ21252-PA 206 GJ21252-PA 42..185 28..168 364 52.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:29:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20536-PA 174 GK20536-PA 1..174 1..176 866 90.3 Plus
Dwil\GK20914-PA 520 GK20914-PA 281..432 22..173 435 50.7 Plus
Dwil\GK24526-PA 508 GK24526-PA 15..166 23..173 378 47.1 Plus
Dwil\GK12669-PA 639 GK12669-PA 486..633 23..169 374 53.4 Plus
Dwil\GK21428-PA 204 GK21428-PA 15..183 2..168 369 48 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:29:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21017-PA 176 GE21017-PA 1..176 1..176 931 98.3 Plus
Dyak\GE14073-PA 517 GE14073-PA 281..432 22..173 443 50.7 Plus
Dyak\GE21848-PA 502 GE21848-PA 15..166 23..173 380 46.4 Plus
Dyak\GE14421-PA 637 GE14421-PA 484..631 23..169 372 54.1 Plus
Dyak\GE11851-PA 205 GE11851-PA 43..184 30..168 361 53.1 Plus

RE07451.hyp Sequence

Translation from 64 to 594

> RE07451.hyp
MLSLSDPNNAGGIPDKAWQPHFVTLETSMGEITVELYWKHAPNTCRNFAE
LSRRGYYNNVVFHRIIRDFMIQGGDPTGTGRGGASIYGSEFADELHGDLR
HTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVVKR
IGMVETDKNDRPVDPLRIIKAKVEKL*

RE07451.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:05:46
Subject Length Description Subject Range Query Range Score Percent Strand
Cypl-PA 176 CG13892-PA 1..176 1..176 943 100 Plus
CG7747-PA 517 CG7747-PA 281..432 22..173 435 50.7 Plus
CG3511-PB 637 CG3511-PB 484..631 23..169 425 54.1 Plus
CG3511-PA 637 CG3511-PA 484..631 23..169 425 54.1 Plus
CG10907-PA 502 CG10907-PA 15..166 23..173 379 46.4 Plus