Clone RE07818 Report

Search the DGRC for RE07818

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:78
Well:18
Vector:pFlc-1
Associated Gene/Transcriptcni-RA
Protein status:RE07818.pep: gold
Sequenced Size:824

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5855 2003-01-01 Sim4 clustering to Release 3
CG5855 2004-01-31 Blastp of sequenced clone
cni 2008-04-29 Release 5.5 accounting
cni 2008-08-15 Release 5.9 accounting
cni 2008-12-18 5.12 accounting

Clone Sequence Records

RE07818.complete Sequence

824 bp (824 high quality bases) assembled on 2004-01-31

GenBank Submission: BT011529

> RE07818.complete
GTCATCATCGCCGCCCTTGTAAAAAAAAAACAACACCTGGAAGACGTGCT
CCAGCGATTTTACAAGATGGCCTTCAACTTCACCGCCTTCACGTACATAG
TGGCCCTGATCGGGGATGCATTCTTGATATTTTTCGCCATATTTCATGTC
ATTGCATTCGACGAACTTAAAACGGATTATAAGAACCCAATTGATCAGTG
CAATAGCCTCAATCCGCTGGTTTTGCCCGAATACCTTCTGCACATCTTTC
TGAACTTGCTCTTCTTGTTCTGCGGCGAATGGTTTTCGCTATGCATCAAC
ATACCCCTCATAGCCTATCATATTTGGCGTTACAAAAACCGCCCTGTGAT
GTCGGGACCCGGACTTTATGATCCCACCACGGTCCTGAAAACCGATACTT
TGTACCGGAACATGCGTGAGGGTTGGATTAAACTGGCCGTCTATCTGATT
AGCTTCTTCTACTACATATACGGCATGGTTTATTCGCTCATCTCGACATA
GGCAAGCTCTTGCCTGGGGATCTCAGTGTTGGCGCCAACGCATCAGCGTC
GTGTATTAGTTGTCTAAACTCGGGTAGAGGACTTCCTTTTTTGGGGAAGA
GTCCCCATCAACCGCGAACAATACTTCACTTGTAAATTCTAGTGTAAATC
CATAAAGACATCTTGAAGCTTTGTTTTTTTCATACAATTTGTAATACTTT
TCTGCAGTAAGAGATTGTAACATGTTTTTATTTTGATTATTTTTTGCATA
TCGCATCTTTGGTGTAGTTGGATTTTAAGCATTAAATAAAAGTCAAATCA
ATGTAACCAAAAAAAAAAAAAAAA

RE07818.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:05:16
Subject Length Description Subject Range Query Range Score Percent Strand
cni-RA 991 cni-RA 40..849 1..810 4050 100 Plus
cni.b 829 cni.b 53..829 34..810 3885 100 Plus
cni-RB 1031 cni-RB 113..889 34..810 3885 100 Plus
cni.b 829 cni.b 7..39 1..33 165 100 Plus
cni-RB 1031 cni-RB 13..45 1..33 165 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:03:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 16308458..16308793 808..473 1680 100 Minus
chr2L 23010047 chr2L 16309303..16309485 216..34 915 100 Minus
chr2L 23010047 chr2L 16308862..16309006 473..329 725 100 Minus
chr2L 23010047 chr2L 16309129..16309242 329..216 570 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:30:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:03:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16309594..16309931 810..473 1690 100 Minus
2L 23513712 2L 16310441..16310623 216..34 915 100 Minus
2L 23513712 2L 16310000..16310144 473..329 725 100 Minus
2L 23513712 2L 16310267..16310380 329..216 570 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16309594..16309931 810..473 1690 100 Minus
2L 23513712 2L 16310441..16310623 216..34 915 100 Minus
2L 23513712 2L 16310000..16310144 473..329 725 100 Minus
2L 23513712 2L 16310267..16310380 329..216 570 100 Minus
2L 23513712 2L 16310691..16310723 33..1 165 100 Minus
Blast to na_te.dros performed on 2019-03-15 16:03:17 has no hits.

RE07818.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:04:34 Download gff for RE07818.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 16308458..16308792 474..808 100 <- Minus
chr2L 16308862..16309005 330..473 100 <- Minus
chr2L 16309129..16309241 217..329 100 <- Minus
chr2L 16309303..16309485 34..216 100 <- Minus
chr2L 16309553..16309585 1..33 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:50:47 Download gff for RE07818.complete
Subject Subject Range Query Range Percent Splice Strand
cni-RB 1..435 67..501 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:40:32 Download gff for RE07818.complete
Subject Subject Range Query Range Percent Splice Strand
cni-RB 1..435 67..501 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:50:38 Download gff for RE07818.complete
Subject Subject Range Query Range Percent Splice Strand
cni-RA 1..435 67..501 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:29:22 Download gff for RE07818.complete
Subject Subject Range Query Range Percent Splice Strand
cni-RB 1..435 67..501 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:24:51 Download gff for RE07818.complete
Subject Subject Range Query Range Percent Splice Strand
cni-RA 1..435 67..501 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:49:31 Download gff for RE07818.complete
Subject Subject Range Query Range Percent Splice Strand
cni-RA 14..821 1..808 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:40:32 Download gff for RE07818.complete
Subject Subject Range Query Range Percent Splice Strand
cni-RA 14..821 1..808 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:50:38 Download gff for RE07818.complete
Subject Subject Range Query Range Percent Splice Strand
cni-RA 4..811 1..808 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:29:23 Download gff for RE07818.complete
Subject Subject Range Query Range Percent Splice Strand
cni-RA 14..821 1..808 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:24:51 Download gff for RE07818.complete
Subject Subject Range Query Range Percent Splice Strand
cni-RA 4..811 1..808 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:04:34 Download gff for RE07818.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16310267..16310379 217..329 100 <- Minus
2L 16310441..16310623 34..216 100 <- Minus
2L 16310691..16310723 1..33 100   Minus
2L 16309596..16309930 474..808 100 <- Minus
2L 16310000..16310143 330..473 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:04:34 Download gff for RE07818.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16310267..16310379 217..329 100 <- Minus
2L 16310441..16310623 34..216 100 <- Minus
2L 16310691..16310723 1..33 100   Minus
2L 16309596..16309930 474..808 100 <- Minus
2L 16310000..16310143 330..473 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:04:34 Download gff for RE07818.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16310267..16310379 217..329 100 <- Minus
2L 16310441..16310623 34..216 100 <- Minus
2L 16310691..16310723 1..33 100   Minus
2L 16309596..16309930 474..808 100 <- Minus
2L 16310000..16310143 330..473 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:50:38 Download gff for RE07818.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16310441..16310623 34..216 100 <- Minus
arm_2L 16310691..16310723 1..33 100   Minus
arm_2L 16310267..16310379 217..329 100 <- Minus
arm_2L 16309596..16309930 474..808 100 <- Minus
arm_2L 16310000..16310143 330..473 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:01:46 Download gff for RE07818.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16309596..16309930 474..808 100 <- Minus
2L 16310000..16310143 330..473 100 <- Minus
2L 16310267..16310379 217..329 100 <- Minus
2L 16310441..16310623 34..216 100 <- Minus
2L 16310691..16310723 1..33 100   Minus

RE07818.hyp Sequence

Translation from 0 to 500

> RE07818.hyp
VIIAALVKKKQHLEDVLQRFYKMAFNFTAFTYIVALIGDAFLIFFAIFHV
IAFDELKTDYKNPIDQCNSLNPLVLPEYLLHIFLNLLFLFCGEWFSLCIN
IPLIAYHIWRYKNRPVMSGPGLYDPTTVLKTDTLYRNMREGWIKLAVYLI
SFFYYIYGMVYSLIST*

RE07818.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:05:06
Subject Length Description Subject Range Query Range Score Percent Strand
cni-PC 144 CG5855-PC 1..144 23..166 775 100 Plus
cni-PB 144 CG5855-PB 1..144 23..166 775 100 Plus
cni-PA 144 CG5855-PA 1..144 23..166 775 100 Plus
cnir-PA 157 CG17262-PA 8..140 31..164 169 28.7 Plus

RE07818.pep Sequence

Translation from 66 to 500

> RE07818.pep
MAFNFTAFTYIVALIGDAFLIFFAIFHVIAFDELKTDYKNPIDQCNSLNP
LVLPEYLLHIFLNLLFLFCGEWFSLCINIPLIAYHIWRYKNRPVMSGPGL
YDPTTVLKTDTLYRNMREGWIKLAVYLISFFYYIYGMVYSLIST*

RE07818.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:33:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15325-PA 144 GF15325-PA 1..144 1..144 747 99.3 Plus
Dana\GF22791-PA 205 GF22791-PA 1..52 1..52 266 98.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:33:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24173-PA 144 GG24173-PA 1..144 1..144 742 98.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:33:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11430-PA 144 GH11430-PA 1..144 1..144 696 92.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:41
Subject Length Description Subject Range Query Range Score Percent Strand
cni-PC 144 CG5855-PC 1..144 1..144 775 100 Plus
cni-PB 144 CG5855-PB 1..144 1..144 775 100 Plus
cni-PA 144 CG5855-PA 1..144 1..144 775 100 Plus
cnir-PA 157 CG17262-PA 8..140 9..142 169 28.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:33:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14694-PA 144 GI14694-PA 1..144 1..144 668 95.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:33:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14087-PA 144 GL14087-PA 1..144 1..144 724 96.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:33:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19182-PA 144 GA19182-PA 1..144 1..144 724 96.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:33:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17911-PA 144 GM17911-PA 1..144 1..144 739 98.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:33:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21921-PA 144 GD21921-PA 1..144 1..144 747 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:33:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17163-PA 144 GJ17163-PA 1..144 1..144 668 95.8 Plus
Dvir\GJ10862-PA 157 GJ10862-PA 32..141 33..143 137 29.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:33:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23716-PA 144 GK23716-PA 1..144 1..144 735 96.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:33:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19367-PA 144 GE19367-PA 1..144 1..144 742 98.6 Plus