Clone RE07893 Report

Search the DGRC for RE07893

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:78
Well:93
Vector:pFlc-1
Associated Gene/TranscriptObp99c-RA
Protein status:RE07893.pep: gold
Sequenced Size:591

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7584 2001-12-14 Blastp of sequenced clone
CG7584 2002-01-01 Sim4 clustering to Release 2
CG7584 2003-01-01 Sim4 clustering to Release 3
Obp99c 2008-04-29 Release 5.5 accounting
Obp99c 2008-08-15 Release 5.9 accounting
Obp99c 2008-12-18 5.12 accounting

Clone Sequence Records

RE07893.complete Sequence

591 bp (591 high quality bases) assembled on 2001-12-14

GenBank Submission: AY070983

> RE07893.complete
AGTTCAGAACCTCAACTTCGCCGCGATCGTGCAACTATAACTAACTATAT
CTCAATATGCTCAAGTATCTGATCGTAGCTCTGGCCCTCTGTGCTGTGGC
CCATGCCGATGACTGGACGCCCAAGACTGGTGAGGAGATCAGGAAAATCC
GCGTTGATTGCCTCAAGGAGAATCCGCTGAGCAACGACCAGATCTCCCAG
CTGAAGAACCTGATCTTCCCCAATGAGCCCGACGTGCGCCAGTACCTGAC
CTGCTCGGCCATCAAGCTGGGCATCTTCTGCGACCAACAGGGCTACCACG
CCGACCGCCTGGCCAAGCAGTTCAAGATGGACCTGTCCGAGGAGGAGGCC
CTTCAGATCGCCCAGAGCTGCGTGGACGACAACGCGCAGAAGAATCCCAC
GGATGTGTGGGCCTTTCGCGGACACCAGTGCATGATGGCCAGTAAGATCG
GCGACAAGGTCAGGGCCTTCGTGAAGGCCAAGGCGGAGGAGGCCAAAAAG
AAGGCCGCCTAGGTCTGAATTTTCGGTCTCAACCAATAAAATGTGTTCAT
CTCTATGCTGAAATGCAACCATTCGAAAAAAAAAAAAAAAA

RE07893.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:38:50
Subject Length Description Subject Range Query Range Score Percent Strand
Obp99c.a 949 Obp99c.a 373..949 1..577 2885 100 Plus
Obp99c-RA 781 Obp99c-RA 205..781 1..577 2885 100 Plus
nc_19927.a 178 nc_19927.a 71..178 97..204 540 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:04:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25508362..25508839 575..98 2270 98.3 Minus
chr3R 27901430 chr3R 25509300..25509398 99..1 465 98 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:30:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:04:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29685734..29686213 577..98 2400 100 Minus
3R 32079331 3R 29686681..29686779 99..1 495 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:06:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29426565..29427044 577..98 2400 100 Minus
3R 31820162 3R 29427512..29427610 99..1 495 100 Minus
Blast to na_te.dros performed on 2019-03-16 10:04:26 has no hits.

RE07893.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:05:12 Download gff for RE07893.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25508362..25508838 99..575 98 <- Minus
chr3R 25509301..25509398 1..98 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:50:53 Download gff for RE07893.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99c-RA 1..456 57..512 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:02:52 Download gff for RE07893.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99c-RA 1..456 57..512 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:23:43 Download gff for RE07893.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99c-RA 1..456 57..512 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:27:26 Download gff for RE07893.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99c-RA 1..456 57..512 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:54:13 Download gff for RE07893.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99c-RA 1..456 57..512 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:29:48 Download gff for RE07893.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99c-RA 4..578 1..575 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:02:52 Download gff for RE07893.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99c-RA 4..578 1..575 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:23:43 Download gff for RE07893.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99c-RA 6..580 1..575 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:27:27 Download gff for RE07893.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99c-RA 4..578 1..575 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:54:13 Download gff for RE07893.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99c-RA 6..580 1..575 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:05:12 Download gff for RE07893.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29685736..29686212 99..575 100 <- Minus
3R 29686682..29686779 1..98 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:05:12 Download gff for RE07893.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29685736..29686212 99..575 100 <- Minus
3R 29686682..29686779 1..98 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:05:12 Download gff for RE07893.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29685736..29686212 99..575 100 <- Minus
3R 29686682..29686779 1..98 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:23:43 Download gff for RE07893.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25511458..25511934 99..575 100 <- Minus
arm_3R 25512404..25512501 1..98 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:03:17 Download gff for RE07893.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29427513..29427610 1..98 100   Minus
3R 29426567..29427043 99..575 100 <- Minus

RE07893.hyp Sequence

Translation from 56 to 511

> RE07893.hyp
MLKYLIVALALCAVAHADDWTPKTGEEIRKIRVDCLKENPLSNDQISQLK
NLIFPNEPDVRQYLTCSAIKLGIFCDQQGYHADRLAKQFKMDLSEEEALQ
IAQSCVDDNAQKNPTDVWAFRGHQCMMASKIGDKVRAFVKAKAEEAKKKA
A*

RE07893.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:48:35
Subject Length Description Subject Range Query Range Score Percent Strand
Obp99c-PA 151 CG7584-PA 1..151 1..151 789 100 Plus
Obp99c-PB 61 CG7584-PB 1..61 91..151 313 100 Plus
Obp44a-PB 143 CG2297-PB 5..133 7..131 191 28.7 Plus
Obp44a-PA 143 CG2297-PA 5..133 7..131 191 28.7 Plus

RE07893.pep Sequence

Translation from 56 to 511

> RE07893.pep
MLKYLIVALALCAVAHADDWTPKTGEEIRKIRVDCLKENPLSNDQISQLK
NLIFPNEPDVRQYLTCSAIKLGIFCDQQGYHADRLAKQFKMDLSEEEALQ
IAQSCVDDNAQKNPTDVWAFRGHQCMMASKIGDKVRAFVKAKAEEAKKKA
A*

RE07893.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:23:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22873-PA 146 GF22873-PA 1..143 1..144 614 76.4 Plus
Dana\GF11209-PA 144 GF11209-PA 5..133 7..131 173 27.1 Plus
Dana\GF23357-PA 142 GF23357-PA 1..131 2..131 150 25.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:23:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12008-PA 151 GG12008-PA 1..151 1..151 751 91.4 Plus
Dere\GG10672-PA 143 GG10672-PA 5..133 7..131 193 29.5 Plus
Dere\GG18298-PA 158 GG18298-PA 37..144 30..133 135 31 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:23:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18683-PA 151 GH18683-PA 1..141 1..140 534 68.1 Plus
Dgri\GH19983-PA 144 GH19983-PA 5..133 7..131 183 28.7 Plus
Dgri\GH13991-PA 157 GH13991-PA 33..148 19..131 141 29.1 Plus
Dgri\GH18907-PA 149 GH18907-PA 1..131 2..131 135 25 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:40
Subject Length Description Subject Range Query Range Score Percent Strand
Obp99c-PA 151 CG7584-PA 1..151 1..151 789 100 Plus
Obp99c-PB 61 CG7584-PB 1..61 91..151 313 100 Plus
Obp44a-PB 143 CG2297-PB 5..133 7..131 191 28.7 Plus
Obp44a-PA 143 CG2297-PA 5..133 7..131 191 28.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:23:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24193-PA 151 GI24193-PA 1..140 1..139 528 66.4 Plus
Dmoj\GI20270-PA 144 GI20270-PA 5..133 7..131 200 30.2 Plus
Dmoj\GI23406-PA 142 GI23406-PA 1..131 2..131 164 25.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:23:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13581-PA 151 GL13581-PA 1..151 1..150 611 74.8 Plus
Dper\GL17379-PA 144 GL17379-PA 5..134 7..131 190 29.2 Plus
Dper\GL13898-PA 142 GL13898-PA 1..127 2..127 138 26.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:23:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp99c-PA 135 GA26831-PA 1..135 1..150 535 68.7 Plus
Dpse\Obp44a-PA 144 GA15343-PA 5..134 7..131 190 29.2 Plus
Dpse\Obp99a-PA 142 GA14801-PA 1..127 2..127 138 26.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:23:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12230-PA 151 GM12230-PA 1..151 1..151 783 96.7 Plus
Dsec\GM20719-PA 143 GM20719-PA 5..133 4..131 187 27.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:23:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp99c-PA 151 GD17690-PA 1..151 1..151 786 97.4 Plus
Dsim\Obp44a-PA 143 GD10185-PA 5..133 7..131 186 28.7 Plus
Dsim\Obp99a-PA 142 GD21447-PA 1..132 2..132 134 24.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:23:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Obp99c-PA 155 GJ10540-PA 1..140 1..139 539 67.9 Plus
Dvir\Obp44a-PA 144 GJ20223-PA 5..133 7..131 186 27.9 Plus
Dvir\Obp99a-PA 142 GJ10612-PA 1..131 2..131 149 27.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:23:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11172-PA 151 GK11172-PA 1..151 1..150 613 75.5 Plus
Dwil\GK23043-PA 144 GK23043-PA 5..133 7..131 204 31.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:23:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Obp99c-PA 151 GE10439-PA 1..139 1..139 710 93.5 Plus
Dyak\GE23275-PA 143 GE23275-PA 5..133 7..131 185 28.7 Plus
Dyak\Obp99a-PA 144 GE23865-PA 1..134 1..132 135 23.1 Plus