Clone RE08075 Report

Search the DGRC for RE08075

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:80
Well:75
Vector:pFlc-1
Associated Gene/TranscriptCG13618-RA
Protein status:RE08075.pep: gold
Preliminary Size:717
Sequenced Size:1030

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13618 2001-12-17 Blastp of sequenced clone
CG13618 2002-01-01 Sim4 clustering to Release 2
CG13618 2003-01-01 Sim4 clustering to Release 3
CG13618 2008-04-29 Release 5.5 accounting
CG13618 2008-08-15 Release 5.9 accounting
CG13618 2008-12-18 5.12 accounting

Clone Sequence Records

RE08075.complete Sequence

1030 bp (1030 high quality bases) assembled on 2001-12-17

GenBank Submission: AY070987

> RE08075.complete
GTACACAGTGATAAGTCTTCGGCCAGAACCACCTGTCACCTGAACCGAAA
ACGGAAGTCGCGCGCGCGTGTAGCCATCTCTTCGTGCCGAGTGTCAATTG
AAATTTGGCTGTGGCTCTTGGTCAATCGATTTCGTACATCCGATCCGATT
TCGTACATCCCCCCGGACGAAATATGTCAAAATACTCGCTACTACTAATG
CTGCTGCTAATCGCTGCGGTTGCGCAGGAACTTACTGTAACGGCTGCGCA
AGAATTGCCCGAAGGCTTTCCCAAGTGCAAACGGGACGCGAACTTCGACA
AATGCCTGGTGGATGCCGTCAATGTGGCGATACAGCAGCTGAAGGCGGGC
AATAGGGAATTTGGCATCCCGCCCCTCGAACCGCTGACCGTAAAGAAACT
CGTTATAGACGCCGGCAATGCGCCAATAAATCTGCGCCAGGCCTTGAAGA
ATGTGAAGGTGCACGACATGATCTCCACCAGCAAGATCCAGCGGTACAGA
ACCGATCTGGATAAGCACTTGATTATCTGTGATAGCCGAACGGATCGCAT
AGAGATGATTGGCGACTACGAGATGTCCGGCCGCATCCTTCTGCTGCCCA
TCACGGGACATGGAAAGGCCAATGTCACGCTGATCAACACCAAGATCGAG
CATCGCCTGATCGGCGAACCCTTTGAGAAGGATGGCGTCAAGTACATGCG
ACTAAAGGACTACCGGGTGTCCTTCGATCCCAAGAGGGTGTACATGAACT
TCGAGAATCTATTCAACGACAAAACTCTGTCGGATGGTATGAATCGATTC
CTTAACGAAAACTGGGAGACGGTGTTCAACGAACTAAAGGTGGGATATGC
CAAGAGTTTCGGCATCATCTTCAGGGAGCTGTCCAACAAACTGTTCGAGA
AAGTGCCCTTCGATAATATATTCTTAAGTTAAGTGCTTAAACAGCTTTCA
ATTACGTACCTATTAGGTAATGCTTAATTTATGTTACTACATAGTTAATA
AAGGTCTTAAACGATAAAAAAAAAAAAAAA

RE08075.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:36:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG13618-RA 1121 CG13618-RA 75..1094 1..1020 5085 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:43:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20350283..20350801 497..1015 2595 100 Plus
chr3R 27901430 chr3R 20348068..20348325 1..258 1290 100 Plus
chr3R 27901430 chr3R 20350018..20350169 348..499 760 100 Plus
chr3R 27901430 chr3R 20349867..20349957 259..349 455 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:30:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:43:10
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24527015..24527538 497..1020 2605 99.8 Plus
3R 32079331 3R 24524800..24525057 1..258 1290 100 Plus
3R 32079331 3R 24526750..24526901 348..499 760 100 Plus
3R 32079331 3R 24526599..24526689 259..349 455 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24267846..24268369 497..1020 2605 99.8 Plus
3R 31820162 3R 24265631..24265888 1..258 1290 100 Plus
3R 31820162 3R 24267581..24267732 348..499 760 100 Plus
3R 31820162 3R 24267430..24267520 259..349 455 100 Plus
Blast to na_te.dros performed on 2019-03-16 18:43:10 has no hits.

RE08075.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:44:17 Download gff for RE08075.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20349867..20349956 259..348 100 -> Plus
chr3R 20350019..20350169 349..499 100 -> Plus
chr3R 20348068..20348325 1..258 100 -> Plus
chr3R 20350286..20350801 500..1015 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:51:06 Download gff for RE08075.complete
Subject Subject Range Query Range Percent Splice Strand
CG13618-RA 1..759 174..932 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:00:03 Download gff for RE08075.complete
Subject Subject Range Query Range Percent Splice Strand
CG13618-RA 1..759 174..932 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:16:29 Download gff for RE08075.complete
Subject Subject Range Query Range Percent Splice Strand
CG13618-RA 1..759 174..932 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:24:41 Download gff for RE08075.complete
Subject Subject Range Query Range Percent Splice Strand
CG13618-RA 1..759 174..932 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:47:51 Download gff for RE08075.complete
Subject Subject Range Query Range Percent Splice Strand
CG13618-RA 1..759 174..932 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:25:50 Download gff for RE08075.complete
Subject Subject Range Query Range Percent Splice Strand
CG13618-RA 1..1015 1..1015 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:00:03 Download gff for RE08075.complete
Subject Subject Range Query Range Percent Splice Strand
CG13618-RA 1..1015 1..1015 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:16:29 Download gff for RE08075.complete
Subject Subject Range Query Range Percent Splice Strand
CG13618-RA 7..1021 1..1015 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:24:41 Download gff for RE08075.complete
Subject Subject Range Query Range Percent Splice Strand
CG13618-RA 1..1015 1..1015 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:47:51 Download gff for RE08075.complete
Subject Subject Range Query Range Percent Splice Strand
CG13618-RA 7..1021 1..1015 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:44:17 Download gff for RE08075.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24527018..24527533 500..1015 100   Plus
3R 24524800..24525057 1..258 100 -> Plus
3R 24526599..24526688 259..348 100 -> Plus
3R 24526751..24526901 349..499 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:44:17 Download gff for RE08075.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24527018..24527533 500..1015 100   Plus
3R 24524800..24525057 1..258 100 -> Plus
3R 24526599..24526688 259..348 100 -> Plus
3R 24526751..24526901 349..499 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:44:17 Download gff for RE08075.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24527018..24527533 500..1015 100   Plus
3R 24524800..24525057 1..258 100 -> Plus
3R 24526599..24526688 259..348 100 -> Plus
3R 24526751..24526901 349..499 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:16:29 Download gff for RE08075.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20352473..20352623 349..499 100 -> Plus
arm_3R 20350522..20350779 1..258 100 -> Plus
arm_3R 20352321..20352410 259..348 100 -> Plus
arm_3R 20352740..20353255 500..1015 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:00:03 Download gff for RE08075.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24265631..24265888 1..258 100 -> Plus
3R 24267430..24267519 259..348 100 -> Plus
3R 24267582..24267732 349..499 100 -> Plus
3R 24267849..24268364 500..1015 100   Plus

RE08075.pep Sequence

Translation from 173 to 931

> RE08075.pep
MSKYSLLLMLLLIAAVAQELTVTAAQELPEGFPKCKRDANFDKCLVDAVN
VAIQQLKAGNREFGIPPLEPLTVKKLVIDAGNAPINLRQALKNVKVHDMI
STSKIQRYRTDLDKHLIICDSRTDRIEMIGDYEMSGRILLLPITGHGKAN
VTLINTKIEHRLIGEPFEKDGVKYMRLKDYRVSFDPKRVYMNFENLFNDK
TLSDGMNRFLNENWETVFNELKVGYAKSFGIIFRELSNKLFEKVPFDNIF
LS*

RE08075.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:10:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20756-PA 251 GF20756-PA 1..250 1..251 1207 94 Plus
Dana\GF11323-PA 261 GF11323-PA 15..256 14..250 316 30.9 Plus
Dana\GF17553-PA 248 GF17553-PA 1..245 9..250 298 30.9 Plus
Dana\GF17554-PA 254 GF17554-PA 3..251 6..251 297 29.4 Plus
Dana\GF21371-PA 263 GF21371-PA 13..260 8..250 242 25.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:10:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11299-PA 251 GG11299-PA 1..251 1..252 1305 98 Plus
Dere\GG11380-PA 250 GG11380-PA 3..249 8..251 330 33.2 Plus
Dere\GG20212-PA 259 GG20212-PA 33..257 27..250 313 31 Plus
Dere\GG11379-PA 248 GG11379-PA 1..245 9..250 288 29 Plus
Dere\GG11378-PA 250 GG11378-PA 1..248 8..251 254 28 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:10:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18827-PA 250 GH18827-PA 1..250 1..252 1188 88.1 Plus
Dgri\GH17381-PA 246 GH17381-PA 4..245 10..251 366 32.3 Plus
Dgri\GH18842-PA 260 GH18842-PA 6..255 7..250 316 30.3 Plus
Dgri\GH14735-PA 237 GH14735-PA 4..235 10..250 270 28.2 Plus
Dgri\GH17382-PA 259 GH17382-PA 22..250 25..250 266 30.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:45:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG13618-PA 252 CG13618-PA 1..252 1..252 1294 100 Plus
CG11854-PB 250 CG11854-PB 3..249 6..251 327 32.4 Plus
CG10407-PB 259 CG10407-PB 1..256 1..249 326 30.7 Plus
CG10407-PA 259 CG10407-PA 1..256 1..249 326 30.7 Plus
CG10407-PC 263 CG10407-PC 1..260 1..249 311 30.3 Plus
to-PB 249 CG11853-PB 1..245 9..250 281 29 Plus
to-PA 249 CG11853-PA 1..245 9..250 281 29 Plus
CG11852-PA 250 CG11852-PA 1..248 8..251 256 28.3 Plus
CG10264-PA 270 CG10264-PA 42..264 26..245 235 27.7 Plus
CG2016-PD 249 CG2016-PD 5..243 7..247 221 24.1 Plus
CG2016-PB 249 CG2016-PB 5..243 7..247 221 24.1 Plus
CG14661-PB 246 CG14661-PB 2..244 3..250 218 27.4 Plus
CG14661-PA 246 CG14661-PA 2..244 3..250 218 27.4 Plus
CG2016-PE 254 CG2016-PE 5..248 7..247 215 23.6 Plus
CG2650-PA 260 CG2650-PA 23..257 22..250 204 23.4 Plus
CG17189-PC 271 CG17189-PC 6..248 8..245 197 26.6 Plus
CG17189-PB 271 CG17189-PB 6..248 8..245 197 26.6 Plus
CG14259-PA 289 CG14259-PA 14..264 4..245 197 25.6 Plus
CG31189-PB 258 CG31189-PB 23..249 28..251 193 25.8 Plus
CG5945-PB 250 CG5945-PB 29..245 33..247 189 24 Plus
CG5945-PA 250 CG5945-PA 29..245 33..247 189 24 Plus
CG5867-PA 262 CG5867-PA 9..256 5..247 189 24.7 Plus
CG17279-PD 245 CG17279-PD 18..243 27..250 188 22.3 Plus
CG14457-PB 271 CG14457-PB 1..254 1..252 186 24 Plus
CG7079-PB 255 CG7079-PB 20..250 26..252 172 24.9 Plus
CG7079-PA 255 CG7079-PA 20..250 26..252 172 24.9 Plus
CG31207-PA 258 CG31207-PA 5..248 11..251 158 22.4 Plus
CG2016-PC 183 CG2016-PC 2..177 73..247 150 21.9 Plus
CG14457-PA 144 CG14457-PA 1..127 126..252 149 28.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:10:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10085-PA 254 GI10085-PA 1..254 1..252 1133 85.4 Plus
Dmoj\GI10103-PA 293 GI10103-PA 41..290 6..252 305 30.1 Plus
Dmoj\GI23925-PA 241 GI23925-PA 1..239 9..250 281 28.6 Plus
Dmoj\GI23926-PA 238 GI23926-PA 3..236 21..251 277 29.4 Plus
Dmoj\GI16254-PA 228 GI16254-PA 9..226 42..251 221 26.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:10:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21869-PA 240 GL21869-PA 18..240 30..252 1114 93.3 Plus
Dper\GL11988-PA 251 GL11988-PA 1..247 1..252 304 31.7 Plus
Dper\GL11989-PA 256 GL11989-PA 26..255 25..251 280 29.8 Plus
Dper\GL12408-PA 265 GL12408-PA 37..260 28..250 279 29.3 Plus
Dper\GL11987-PA 250 GL11987-PA 2..248 6..251 244 27.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12411-PA 253 GA12411-PA 10..253 9..252 1201 92.2 Plus
Dpse\GA11237-PA 251 GA11237-PA 1..247 1..252 304 31.7 Plus
Dpse\GA11238-PA 256 GA11238-PA 26..255 25..251 284 30.2 Plus
Dpse\GA10301-PA 265 GA10301-PA 37..260 28..250 278 29.3 Plus
Dpse\GA11236-PA 250 GA11236-PA 2..248 6..251 244 27.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:10:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26607-PA 119 GM26607-PA 1..119 134..252 629 100 Plus
Dsec\GM26606-PA 133 GM26606-PA 1..66 1..66 336 97 Plus
Dsec\GM25738-PA 230 GM25738-PA 4..228 27..250 315 31.4 Plus
Dsec\GM17823-PA 246 GM17823-PA 20..245 25..251 295 31.5 Plus
Dsec\GM17822-PA 249 GM17822-PA 1..245 9..250 286 29 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:10:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21191-PA 250 GD21191-PA 16..249 21..251 323 33.8 Plus
Dsim\GD20311-PA 199 GD20311-PA 4..197 27..250 272 29.2 Plus
Dsim\GD21190-PA 241 GD21190-PA 25..237 43..250 270 29.4 Plus
Dsim\GD21189-PA 250 GD21189-PA 1..248 8..251 262 28.4 Plus
Dsim\GD19070-PA 270 GD19070-PA 42..264 26..245 234 27.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:10:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23820-PA 254 GJ23820-PA 1..254 1..252 1198 87.4 Plus
Dvir\GJ24019-PA 245 GJ24019-PA 1..243 1..250 351 34.5 Plus
Dvir\GJ24018-PA 246 GJ24018-PA 12..244 21..250 349 34.6 Plus
Dvir\GJ23840-PA 260 GJ23840-PA 4..255 5..250 321 30.8 Plus
Dvir\GJ24020-PA 255 GJ24020-PA 2..252 3..250 311 29 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:10:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22344-PA 190 GK22344-PA 10..188 5..189 825 84.3 Plus
Dwil\GK14019-PA 258 GK14019-PA 25..253 23..250 328 31.7 Plus
Dwil\GK13452-PA 254 GK13452-PA 24..252 26..251 273 28.9 Plus
Dwil\GK13451-PA 244 GK13451-PA 11..242 20..245 267 30.4 Plus
Dwil\GK13450-PA 250 GK13450-PA 1..248 8..251 253 27.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:10:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23494-PA 251 GE23494-PA 1..251 1..252 1303 98 Plus
Dyak\GE23577-PA 250 GE23577-PA 3..249 6..251 334 33.5 Plus
Dyak\GE26341-PA 259 GE26341-PA 33..257 27..250 317 31.4 Plus
Dyak\to-PA 248 GE23576-PA 1..245 9..250 295 29.8 Plus
Dyak\GE23575-PA 251 GE23575-PA 1..249 7..251 257 27.9 Plus

RE08075.hyp Sequence

Translation from 173 to 931

> RE08075.hyp
MSKYSLLLMLLLIAAVAQELTVTAAQELPEGFPKCKRDANFDKCLVDAVN
VAIQQLKAGNREFGIPPLEPLTVKKLVIDAGNAPINLRQALKNVKVHDMI
STSKIQRYRTDLDKHLIICDSRTDRIEMIGDYEMSGRILLLPITGHGKAN
VTLINTKIEHRLIGEPFEKDGVKYMRLKDYRVSFDPKRVYMNFENLFNDK
TLSDGMNRFLNENWETVFNELKVGYAKSFGIIFRELSNKLFEKVPFDNIF
LS*

RE08075.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:54:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG13618-PA 252 CG13618-PA 1..252 1..252 1294 100 Plus
CG11854-PB 250 CG11854-PB 3..249 6..251 327 32.4 Plus
CG10407-PB 259 CG10407-PB 1..256 1..249 326 30.7 Plus
CG10407-PA 259 CG10407-PA 1..256 1..249 326 30.7 Plus
to-PB 249 CG11853-PB 1..245 9..250 281 29 Plus