Clone RE08270 Report

Search the DGRC for RE08270

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:82
Well:70
Vector:pFlc-1
Associated Gene/TranscriptRpS15-RA
Protein status:RE08270.pep: gold
Sequenced Size:649

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8332 2001-12-14 Blastp of sequenced clone
CG8332 2002-01-01 Sim4 clustering to Release 2
RpS15 2008-04-29 Release 5.5 accounting
RpS15 2008-08-15 Release 5.9 accounting
RpS15 2008-12-18 5.12 accounting

Clone Sequence Records

RE08270.complete Sequence

649 bp (649 high quality bases) assembled on 2001-12-14

GenBank Submission: AY070991

> RE08270.complete
GCTTTAAATCTCTTTCCGTTTTTGTGCGCAACCAAAAAAGATGGCCGATC
AAGTCGATGAAAATCTGAAGAAGAAGCGTACCTTCAAGAAGTTCACCTAC
CGCGGTGTCGACTTGGACCAGCTTCTGGACATGCCCAACAACCAGCTGGT
GGAGCTGATGCACAGCCGTGCCCGCAGGCGTTTCTCCCGCGGACTGAAGC
GCAAGCCAATGGCTCTGATCAAGAAGCTGCGCAAGGCCAAGAAGGAGGCA
CCGCCAAATGAGAAGCCCGAGATTGTCAAGACCCACCTGAGGAACATGAT
CATCGTACCCGAGATGACCGGCTCCATCATTGGCGTCTACAACGGCAAGG
ACTTCGGACAGGTGGAGGTCAAGCCCGAGATGATCGGTCACTACCTGGGC
GAGTTCGCCCTGACCTACAAGCCCGTCAAGCACGGTCGTCCTGGTATCGG
TGCCACCCACAGCTCCCGTTTCATTCCTCTGAAGTGAGCGCTGCTCGTCT
TTTGGGCTGTTGAGATGAATGATGCGTGAATAAATGAAACGTACTTTTAT
AAGAACACACCCCCCTCGTCTGCGTTGCGTTTTCCATCTAATGCTTTTCC
AAAAGTAAAGGAGTGGTCGCCACTTAAGAAATGCAAAAAAAAAAAAAAA

RE08270.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
RpS15-RA 728 RpS15-RA 49..681 1..633 3165 100 Plus
RpS15-RB 900 RpS15-RB 270..853 50..633 2920 100 Plus
RpS15-RB 900 RpS15-RB 38..86 1..49 245 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:46:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12457348..12457623 633..358 1365 99.6 Minus
chr2R 21145070 chr2R 12457859..12458083 363..139 1125 100 Minus
chr2R 21145070 chr2R 12458152..12458240 138..50 445 100 Minus
chr2R 21145070 chr2R 12458423..12458471 49..1 245 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:30:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:46:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16570113..16570388 633..358 1380 100 Minus
2R 25286936 2R 16570624..16570848 363..139 1125 100 Minus
2R 25286936 2R 16570917..16571005 138..50 445 100 Minus
2R 25286936 2R 16571189..16571237 49..1 245 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:06:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16571312..16571587 633..358 1380 100 Minus
2R 25260384 2R 16571823..16572047 363..139 1125 100 Minus
2R 25260384 2R 16572116..16572204 138..50 445 100 Minus
2R 25260384 2R 16572388..16572436 49..1 245 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:46:11 has no hits.

RE08270.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:47:18 Download gff for RE08270.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12458152..12458240 50..138 100 <- Minus
chr2R 12458423..12458471 1..49 100   Minus
chr2R 12457347..12457619 362..634 99 <- Minus
chr2R 12457861..12458083 139..361 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:51:15 Download gff for RE08270.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15-RA 1..447 41..487 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:03:20 Download gff for RE08270.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15-RA 1..447 41..487 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:50:21 Download gff for RE08270.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15-RA 1..447 41..487 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:27:58 Download gff for RE08270.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15-RA 1..447 41..487 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:38:37 Download gff for RE08270.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15-RA 1..447 41..487 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:30:26 Download gff for RE08270.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15-RA 1..633 1..634 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:03:19 Download gff for RE08270.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15-RA 1..633 1..634 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:50:21 Download gff for RE08270.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15-RA 1..626 8..634 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:27:58 Download gff for RE08270.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15-RA 1..633 1..634 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:38:37 Download gff for RE08270.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15-RA 1..626 8..634 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:47:18 Download gff for RE08270.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16570112..16570384 362..634 99 <- Minus
2R 16570626..16570848 139..361 100 <- Minus
2R 16570917..16571005 50..138 100 <- Minus
2R 16571189..16571237 1..49 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:47:18 Download gff for RE08270.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16570112..16570384 362..634 99 <- Minus
2R 16570626..16570848 139..361 100 <- Minus
2R 16570917..16571005 50..138 100 <- Minus
2R 16571189..16571237 1..49 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:47:18 Download gff for RE08270.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16570112..16570384 362..634 99 <- Minus
2R 16570626..16570848 139..361 100 <- Minus
2R 16570917..16571005 50..138 100 <- Minus
2R 16571189..16571237 1..49 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:50:21 Download gff for RE08270.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12457617..12457889 362..634 99 <- Minus
arm_2R 12458131..12458353 139..361 100 <- Minus
arm_2R 12458422..12458510 50..138 100 <- Minus
arm_2R 12458694..12458742 1..49 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:03:48 Download gff for RE08270.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16572116..16572204 50..138 100 <- Minus
2R 16572388..16572436 1..49 100   Minus
2R 16571825..16572047 139..361 100 <- Minus
2R 16571311..16571583 362..634 99 <- Minus

RE08270.pep Sequence

Translation from 40 to 486

> RE08270.pep
MADQVDENLKKKRTFKKFTYRGVDLDQLLDMPNNQLVELMHSRARRRFSR
GLKRKPMALIKKLRKAKKEAPPNEKPEIVKTHLRNMIIVPEMTGSIIGVY
NGKDFGQVEVKPEMIGHYLGEFALTYKPVKHGRPGIGATHSSRFIPLK*

RE08270.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:24:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11258-PA 148 GF11258-PA 1..148 1..148 775 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:24:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22261-PA 148 GG22261-PA 1..148 1..148 775 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:24:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20641-PA 148 GH20641-PA 1..148 1..148 770 99.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
RpS15-PA 148 CG8332-PA 1..148 1..148 769 100 Plus
RpS15-PB 147 CG8332-PB 3..147 4..148 754 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:24:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19004-PA 148 GI19004-PA 1..148 1..148 770 99.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:24:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11338-PA 148 GL11338-PA 1..148 1..148 766 98.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:24:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20995-PA 148 GA20995-PA 1..148 1..148 766 98.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:24:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20051-PA 148 GM20051-PA 1..148 1..148 771 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:24:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25532-PA 148 GD25532-PA 1..148 1..148 771 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:24:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19970-PA 148 GJ19970-PA 1..148 1..148 770 99.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:24:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21598-PA 145 GK21598-PA 2..145 5..148 731 97.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:24:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14054-PA 148 GE14054-PA 1..148 1..148 775 100 Plus

RE08270.hyp Sequence

Translation from 40 to 486

> RE08270.hyp
MADQVDENLKKKRTFKKFTYRGVDLDQLLDMPNNQLVELMHSRARRRFSR
GLKRKPMALIKKLRKAKKEAPPNEKPEIVKTHLRNMIIVPEMTGSIIGVY
NGKDFGQVEVKPEMIGHYLGEFALTYKPVKHGRPGIGATHSSRFIPLK*

RE08270.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:48:44
Subject Length Description Subject Range Query Range Score Percent Strand
RpS15-PA 148 CG8332-PA 1..148 1..148 769 100 Plus
RpS15-PB 147 CG8332-PB 3..147 4..148 754 100 Plus