Clone RE08605 Report

Search the DGRC for RE08605

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:86
Well:5
Vector:pFlc-1
Associated Gene/TranscriptsPLA2-RB
Protein status:RE08605.pep: gold
Preliminary Size:561
Sequenced Size:738

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11124 2001-12-14 Blastp of sequenced clone
CG11124 2002-01-01 Sim4 clustering to Release 2
CG11124 2003-01-01 Sim4 clustering to Release 3
sPLA2 2008-04-29 Release 5.5 accounting
sPLA2 2008-08-15 Release 5.9 accounting
sPLA2 2008-12-18 5.12 accounting

Clone Sequence Records

RE08605.complete Sequence

738 bp (738 high quality bases) assembled on 2001-12-14

GenBank Submission: AY070993

> RE08605.complete
AGTGTGCTGCGACTGCCGAAGCTGAGACATGTGGCTGCTGCGCGAAGCGT
TCTTTTTTGGGCTACTGGCCATGGCTTGGGCCTTCGGCGACGAGGCTATC
TTTGAGGACGAGGACATCTACAACCAGGCACTGCCACCAGTTCCCCATAC
GGGCATCACGGTGCCCGGAACCAAGTGGTGCGGACCGGGCAACACGGCGG
CGAACTTCGAGGATTTGGGCCGCGAACGGGAGACGGACAAGTGCTGTCGT
GCCCACGACCATTGCGACGAGATTATCGAGTCCCACGGAGCACTCCACGG
ACTGCCCACCAACACAGACTGGTTTCCCATGTAAGCGCCTCAAGTGCACC
TGCGAGCAGCAGTTTATCAATTGCCTGCAGGCAGTGAACAGCATCACGGC
CAAAACTCTGGGTCGTATCTACTATGGCAGCAGGAGCAGGTGCTTTGCCA
ACGGACATCCCACCACCGGATGCAAGCAGTACCAGGAGGGCACCTTCCGC
AAGCGCTGTATCAGCTACCAGGTGGACAAGTCCAAGGCCAAGGTCTGGCA
GTTCTACGACATGCCGTTCTTCACAATCCCAGCGTCGGCGGGCTGACATG
ATATCAACGATTTGTAGACAAGATGATTACATTACCTGATGCGCACATCA
CATTAATTATTACTTATAAGGTAATCCCACTTTAATCTGGATGAAATATA
AAATACTCCGAATATTTTCTAGAAAAAAAAAAAAAAAA

RE08605.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:38:36
Subject Length Description Subject Range Query Range Score Percent Strand
sPLA2-RB 723 sPLA2-RB 4..721 3..720 3575 99.8 Plus
sPLA2-RC 844 sPLA2-RC 445..827 338..720 1900 99.7 Plus
sPLA2-RA 830 sPLA2-RA 445..827 338..720 1900 99.7 Plus
sPLA2-RC 844 sPLA2-RC 117..444 3..330 1640 100 Plus
sPLA2-RA 830 sPLA2-RA 117..444 3..330 1640 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:05:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3330796..3331179 337..720 1905 99.7 Plus
chr2R 21145070 chr2R 3330402..3330736 3..337 1675 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:30:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:05:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7443442..7443825 337..720 1905 99.7 Plus
2R 25286936 2R 7443048..7443382 3..337 1675 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:05:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7444641..7445024 337..720 1905 99.7 Plus
2R 25260384 2R 7444247..7444581 3..337 1675 100 Plus
Blast to na_te.dros performed on 2019-03-15 22:05:14 has no hits.

RE08605.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:06:30 Download gff for RE08605.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3330399..3330736 1..337 99 -> Plus
chr2R 3330797..3331181 338..722 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:51:25 Download gff for RE08605.complete
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RB 1..306 29..334 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:02:32 Download gff for RE08605.complete
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RB 1..306 29..334 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:07:29 Download gff for RE08605.complete
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RA 1..561 29..596 98   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:27:01 Download gff for RE08605.complete
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RB 1..306 29..334 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:11:04 Download gff for RE08605.complete
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RA 1..561 29..596 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:29:21 Download gff for RE08605.complete
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RB 1..723 1..722 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:02:32 Download gff for RE08605.complete
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RB 1..723 1..722 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:07:29 Download gff for RE08605.complete
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RB 3..725 1..722 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:27:01 Download gff for RE08605.complete
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RB 1..723 1..722 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:11:04 Download gff for RE08605.complete
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RB 3..725 1..722 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:06:30 Download gff for RE08605.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7443045..7443382 1..337 99 -> Plus
2R 7443443..7443827 338..722 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:06:30 Download gff for RE08605.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7443045..7443382 1..337 99 -> Plus
2R 7443443..7443827 338..722 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:06:30 Download gff for RE08605.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7443045..7443382 1..337 99 -> Plus
2R 7443443..7443827 338..722 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:07:29 Download gff for RE08605.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3330550..3330887 1..337 99 -> Plus
arm_2R 3330948..3331332 338..722 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:02:54 Download gff for RE08605.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7444244..7444581 1..337 99 -> Plus
2R 7444642..7445026 338..722 99   Plus

RE08605.hyp Sequence

Translation from 0 to 595

> RE08605.hyp
SCAATAEAETCGCCAKRSFLGYWPWLGPSATRLSLRTRTSTTRHCHQFPI
RASRCPEPSGADRATRRRTSRIWAANGRRTSAVVPTTIATRLSSPTEHST
DCPPTQTGFPCKRLKCTCEQQFINCLQAVNSITAKTLGRIYYGSRSRCFA
NGHPTTGCKQYQEGTFRKRCIRYQVDKSKAKVWQFYDMPFFTIPASAG*

RE08605.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:27:41
Subject Length Description Subject Range Query Range Score Percent Strand
sPLA2-PC 186 CG11124-PC 93..186 104..198 472 93.8 Plus
sPLA2-PA 186 CG11124-PA 93..186 104..198 472 93.8 Plus
CG30503-PB 173 CG30503-PB 67..162 103..192 196 35.4 Plus
CG30503-PA 173 CG30503-PA 67..162 103..192 196 35.4 Plus

RE08605.pep Sequence

Translation from 28 to 333

> RE08605.pep
MWLLREAFFFGLLAMAWAFGDEAIFEDEDIYNQALPPVPHTGITVPGTKW
CGPGNTAANFEDLGRERETDKCCRAHDHCDEIIESHGALHGLPTNTDWFP
M*

RE08605.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12957-PA 186 GF12957-PA 19..101 19..101 437 94 Plus
Dana\GF11953-PA 172 GF11953-PA 17..82 35..101 186 53.7 Plus
Dana\GF20851-PA 330 GF20851-PA 96..146 42..92 144 45.1 Plus
Dana\GF22231-PA 309 GF22231-PA 201..251 45..97 137 45.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:20:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23279-PA 186 GG23279-PA 1..101 1..101 524 95 Plus
Dere\GG10751-PA 173 GG10751-PA 25..83 42..101 190 63.3 Plus
Dere\GG18524-PA 342 GG18524-PA 101..151 42..92 142 45.1 Plus
Dere\GG17755-PA 309 GG17755-PA 201..235 45..79 137 57.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21166-PA 189 GH21166-PA 1..101 1..101 473 81.2 Plus
Dgri\GH20736-PA 172 GH20736-PA 21..79 42..101 194 60 Plus
Dgri\GH17900-PA 337 GH17900-PA 101..151 42..92 144 45.1 Plus
Dgri\GH12690-PA 321 GH12690-PA 213..254 45..86 137 50 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:40
Subject Length Description Subject Range Query Range Score Percent Strand
sPLA2-PB 101 CG11124-PB 1..101 1..101 578 100 Plus
sPLA2-PC 186 CG11124-PC 1..101 1..101 574 99 Plus
sPLA2-PA 186 CG11124-PA 1..101 1..101 574 99 Plus
CG30503-PB 173 CG30503-PB 26..83 43..101 199 62.7 Plus
CG30503-PA 173 CG30503-PA 26..83 43..101 199 62.7 Plus
CG3009-PD 239 CG3009-PD 101..151 42..92 148 45.1 Plus
CG3009-PB 342 CG3009-PB 101..151 42..92 148 45.1 Plus
CG3009-PA 342 CG3009-PA 101..151 42..92 148 45.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18761-PA 184 GI18761-PA 1..101 4..101 418 74.3 Plus
Dmoj\GI20819-PA 165 GI20819-PA 21..79 42..101 196 61.7 Plus
Dmoj\GI16365-PA 312 GI16365-PA 204..245 45..86 143 52.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:20:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11167-PA 186 GL11167-PA 1..101 1..101 471 83.2 Plus
Dper\GL10932-PA 168 GL10932-PA 24..82 42..101 179 56.7 Plus
Dper\GL14551-PA 359 GL14551-PA 97..147 42..92 145 45.1 Plus
Dper\GL14950-PA 352 GL14950-PA 201..242 45..86 137 50 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:20:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10773-PA 186 GA10773-PA 1..101 1..101 471 83.2 Plus
Dpse\GA15891-PA 168 GA15891-PA 24..82 42..101 183 58.3 Plus
Dpse\GA15641-PA 334 GA15641-PA 97..147 42..92 145 45.1 Plus
Dpse\GA18124-PA 309 GA18124-PA 201..242 45..86 137 50 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20955-PA 186 GM20955-PA 1..101 1..101 523 95 Plus
Dsec\GM20797-PA 173 GM20797-PA 25..83 42..101 183 60 Plus
Dsec\GM12671-PA 340 GM12671-PA 99..149 42..92 142 45.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10480-PA 186 GD10480-PA 1..101 1..101 536 97 Plus
Dsim\GD10259-PA 173 GD10259-PA 25..83 42..101 186 61.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:20:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21785-PA 187 GJ21785-PA 8..101 8..101 453 84 Plus
Dvir\GJ20552-PA 166 GJ20552-PA 14..79 35..101 195 58.2 Plus
Dvir\GJ16381-PA 337 GJ16381-PA 100..150 42..92 148 45.1 Plus
Dvir\GJ16735-PA 321 GJ16735-PA 213..247 45..79 137 57.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:20:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21320-PA 188 GK21320-PA 1..103 1..101 419 75.2 Plus
Dwil\GK22012-PA 157 GK22012-PA 3..69 34..101 181 52.9 Plus
Dwil\GK25148-PA 983 GK25148-PA 96..146 42..92 148 45.1 Plus
Dwil\GK17378-PA 314 GK17378-PA 206..247 45..86 137 50 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:20:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19126-PA 186 GE19126-PA 1..101 1..101 509 92.1 Plus
Dyak\GE24036-PA 173 GE24036-PA 26..83 43..101 180 61 Plus
Dyak\GE16841-PA 345 GE16841-PA 101..151 42..92 146 47.1 Plus