Clone RE08808 Report

Search the DGRC for RE08808

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:88
Well:8
Vector:pFlc-1
Associated Gene/TranscriptCpr51A-RA
Protein status:RE08808.pep: gold
Preliminary Size:639
Sequenced Size:677

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10112 2001-12-14 Blastp of sequenced clone
CG10112 2002-01-01 Sim4 clustering to Release 2
CG10112 2003-01-01 Sim4 clustering to Release 3
Cpr51A 2008-04-29 Release 5.5 accounting
Cpr51A 2008-08-15 Release 5.9 accounting
Cpr51A 2008-12-18 5.12 accounting

Clone Sequence Records

RE08808.complete Sequence

677 bp (677 high quality bases) assembled on 2001-12-14

GenBank Submission: AY070997

> RE08808.complete
GATCCACAGTCCAAAGTCGCTTGCAGCGAAATACATCTATCCATACCCAG
TGCACAGAAAGTTGAAACACCCCAGAAAATATGTACAAATTCGTGTTGAT
CGCCAGCCTGCTGGTCGCCCTCTGCATGGCAGCTCCTCCCCGCCAGGAAT
CCGAAGCCGAAAGGATAGAGAGGGAGGAGTACGAGAAATATCAGAATGAA
AACGCCCAGTACTCGTTCAATTCGAGTGTGGATGATAAGATCAACGATGG
ACAAATCTCACGTAATGAGGAGCGCGAAGGAGGCACTGTTCGTGGTTCCT
ACAGCTACTTCGATGGTTTCGTGAAGCGCCGTGTTGAGTACATCGCCGAT
AAGGACGGCTACAGGGTGCTCAAGGACGAGATCGAGGATGTCGGCAATGG
TCCTTCGTTCAATCCCGATGGCATAGCCAACGTGGAGGGCTCTATGATCG
GCAAATACTCCATCAAACTGGATAAGGCCGACGATGACAAGCACTACAAG
GACATTCATGCCTAGGGCAAAATGAACTGAGGATTTCTAACATTTAGAAA
CGGACTGAATACTTTGTAGACCCCCAAAATAGAGTAAAACACAATCTGAA
CAAAAAGTGTATTTCTTCTTCTCCCAAATAAAATATTGAAAAAACTTTAA
AAAAAAAAAAGAAAAAAAAAAAAAAAA

RE08808.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:39:29
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr51A-RA 936 Cpr51A-RA 199..853 1..655 3260 99.8 Plus
Cpr51A.a 594 Cpr51A.a 70..584 141..655 2560 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:54:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10399855..10400369 655..141 2560 99.8 Minus
chr2R 21145070 chr2R 10402372..10402511 140..1 700 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:31:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:54:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14512552..14513066 655..141 2560 99.8 Minus
2R 25286936 2R 14515069..14515208 140..1 700 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:06:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14513751..14514265 655..141 2560 99.8 Minus
2R 25260384 2R 14516268..14516407 140..1 700 100 Minus
Blast to na_te.dros performed on 2019-03-16 14:54:11 has no hits.

RE08808.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:54:50 Download gff for RE08808.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10399862..10400369 141..648 100 <- Minus
chr2R 10402372..10402511 1..140 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:51:39 Download gff for RE08808.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr51A-RA 1..435 81..515 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:03:47 Download gff for RE08808.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr51A-RA 1..435 81..515 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:31:10 Download gff for RE08808.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr51A-RA 1..435 81..515 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:28:25 Download gff for RE08808.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr51A-RA 1..435 81..515 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:38:11 Download gff for RE08808.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr51A-RA 1..435 81..515 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:31:03 Download gff for RE08808.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr51A-RA 1..648 1..648 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:03:47 Download gff for RE08808.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr51A-RA 1..648 1..648 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:31:10 Download gff for RE08808.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr51A-RA 4..651 1..648 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:28:25 Download gff for RE08808.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr51A-RA 1..648 1..648 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:38:11 Download gff for RE08808.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr51A-RA 4..651 1..648 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:54:50 Download gff for RE08808.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14515069..14515208 1..140 100   Minus
2R 14512559..14513066 141..648 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:54:50 Download gff for RE08808.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14515069..14515208 1..140 100   Minus
2R 14512559..14513066 141..648 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:54:50 Download gff for RE08808.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14515069..14515208 1..140 100   Minus
2R 14512559..14513066 141..648 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:31:10 Download gff for RE08808.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10402574..10402713 1..140 100   Minus
arm_2R 10400064..10400571 141..648 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:04:19 Download gff for RE08808.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14513758..14514265 141..648 100 <- Minus
2R 14516268..14516407 1..140 100   Minus

RE08808.hyp Sequence

Translation from 80 to 514

> RE08808.hyp
MYKFVLIASLLVALCMAAPPRQESEAERIEREEYEKYQNENAQYSFNSSV
DDKINDGQISRNEEREGGTVRGSYSYFDGFVKRRVEYIADKDGYRVLKDE
IEDVGNGPSFNPDGIANVEGSMIGKYSIKLDKADDDKHYKDIHA*

RE08808.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:50:46
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr51A-PA 144 CG10112-PA 1..144 1..144 750 100 Plus

RE08808.pep Sequence

Translation from 80 to 514

> RE08808.pep
MYKFVLIASLLVALCMAAPPRQESEAERIEREEYEKYQNENAQYSFNSSV
DDKINDGQISRNEEREGGTVRGSYSYFDGFVKRRVEYIADKDGYRVLKDE
IEDVGNGPSFNPDGIANVEGSMIGKYSIKLDKADDDKHYKDIHA*

RE08808.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:28:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11348-PA 143 GF11348-PA 1..143 1..144 601 79.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:28:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22420-PA 144 GG22420-PA 1..144 1..144 685 87.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:28:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21122-PA 144 GH21122-PA 1..141 1..141 459 63.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:34
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr51A-PA 144 CG10112-PA 1..144 1..144 750 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:28:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18726-PA 137 GI18726-PA 1..135 1..142 411 56.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:28:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10644-PA 140 GL10644-PA 1..140 1..144 531 70.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:28:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10081-PA 140 GA10081-PA 1..140 1..144 531 70.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:28:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20207-PA 144 GM20207-PA 1..144 1..144 674 87.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25677-PA 144 GD25677-PA 1..144 1..144 671 86.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21745-PA 144 GJ21745-PA 1..138 1..140 412 55.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:28:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15739-PA 141 GK15739-PA 1..141 1..144 435 59 Plus
Dwil\GK15738-PA 137 GK15738-PA 1..137 1..144 411 57.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:28:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12309-PA 144 GE12309-PA 1..144 1..144 658 84.7 Plus