Clone RE09053 Report

Search the DGRC for RE09053

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:90
Well:53
Vector:pFlc-1
Associated Gene/TranscriptCG15168-RA
Protein status:RE09053.pep: gold
Preliminary Size:330
Sequenced Size:488

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15168 2001-12-14 Blastp of sequenced clone
CG15168 2002-01-01 Sim4 clustering to Release 2
CG15168 2003-01-01 Sim4 clustering to Release 3
CG15168 2008-04-29 Release 5.5 accounting
CG15168 2008-08-15 Release 5.9 accounting
CG15168 2008-12-18 5.12 accounting

Clone Sequence Records

RE09053.complete Sequence

488 bp (488 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071004

> RE09053.complete
TGAGCAAAATTTTGTAGAAAATTGTACCGACTGTGATTGTAATTCGTAAT
TGTTCAATAAAAATGGGCAGTAAACTGTTTAACAAACTCTTGCTAATTGC
CGGATTTGCCAGCCTGGCACATGCTGCTTTTTCTGCTGCCCATCATCGCA
CCTATTTGAGGCTGACGGAGCAGGAATGGAATAGCCTTCCATTGGACATT
ATCCTGCAGACCGTCATCAGTTTGGTGATTGTGATTTACAACATCATCGA
GATCGTTGGCAACTTCAAGGAAATTCGCGCCACCGTGGACATGCAACAGA
AAACTTGGGACACCTTGGGCAACTTCCCCTCGTTCTATTCCTTCAATCAC
CGTGGTCGTGCCTTAAATCCTGGATATACGCCCCCGGAATAAGAGACCTT
TCTTTTAAGTTCTGCTATCCTTTTATTTATAGTCTCAGCAAGTTACAATA
TAGATAACGCTAAAGATCAACCAAAAAAAAAAAAAAAA

RE09053.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:42:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG15168-RA 570 CG15168-RA 58..530 3..475 2365 100 Plus
CG15170-RA 1752 CG15170-RA 1686..1752 475..409 335 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:52:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18986751..18987025 198..472 1375 100 Plus
chr2L 23010047 chr2L 18986423..18986564 3..144 710 100 Plus
chr2L 23010047 chr2L 18986630..18986682 145..197 265 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:31:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:52:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18988057..18988334 198..475 1390 100 Plus
2L 23513712 2L 18987729..18987870 3..144 710 100 Plus
2L 23513712 2L 18987936..18987988 145..197 265 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:09:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18988057..18988334 198..475 1390 100 Plus
2L 23513712 2L 18987729..18987870 3..144 710 100 Plus
2L 23513712 2L 18987936..18987988 145..197 265 100 Plus
Blast to na_te.dros performed on 2019-03-16 18:52:27 has no hits.

RE09053.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:53:17 Download gff for RE09053.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18986421..18986564 1..144 99 -> Plus
chr2L 18986630..18986682 145..197 100 -> Plus
chr2L 18986751..18987025 198..472 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:51:54 Download gff for RE09053.complete
Subject Subject Range Query Range Percent Splice Strand
CG15168-RA 1..330 63..392 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:08:08 Download gff for RE09053.complete
Subject Subject Range Query Range Percent Splice Strand
CG15168-RA 1..330 63..392 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:18:23 Download gff for RE09053.complete
Subject Subject Range Query Range Percent Splice Strand
CG15168-RA 1..330 63..392 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:32:24 Download gff for RE09053.complete
Subject Subject Range Query Range Percent Splice Strand
CG15168-RA 1..330 63..392 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:53:19 Download gff for RE09053.complete
Subject Subject Range Query Range Percent Splice Strand
CG15168-RA 1..330 63..392 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:36:57 Download gff for RE09053.complete
Subject Subject Range Query Range Percent Splice Strand
CG15168-RA 1..431 1..431 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:08:08 Download gff for RE09053.complete
Subject Subject Range Query Range Percent Splice Strand
CG15168-RA 1..472 1..472 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:18:23 Download gff for RE09053.complete
Subject Subject Range Query Range Percent Splice Strand
CG15168-RA 21..492 1..472 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:32:25 Download gff for RE09053.complete
Subject Subject Range Query Range Percent Splice Strand
CG15168-RA 1..431 1..431 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:53:19 Download gff for RE09053.complete
Subject Subject Range Query Range Percent Splice Strand
CG15168-RA 21..492 1..472 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:53:17 Download gff for RE09053.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18987727..18987870 1..144 99 -> Plus
2L 18987936..18987988 145..197 100 -> Plus
2L 18988057..18988331 198..472 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:53:17 Download gff for RE09053.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18987727..18987870 1..144 99 -> Plus
2L 18987936..18987988 145..197 100 -> Plus
2L 18988057..18988331 198..472 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:53:17 Download gff for RE09053.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18987727..18987870 1..144 99 -> Plus
2L 18987936..18987988 145..197 100 -> Plus
2L 18988057..18988331 198..472 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:18:23 Download gff for RE09053.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18987727..18987870 1..144 99 -> Plus
arm_2L 18987936..18987988 145..197 100 -> Plus
arm_2L 18988057..18988331 198..472 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:09:18 Download gff for RE09053.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18988057..18988331 198..472 100   Plus
2L 18987727..18987870 1..144 99 -> Plus
2L 18987936..18987988 145..197 100 -> Plus

RE09053.hyp Sequence

Translation from 62 to 391

> RE09053.hyp
MGSKLFNKLLLIAGFASLAHAAFSAAHHRTYLRLTEQEWNSLPLDIILQT
VISLVIVIYNIIEIVGNFKEIRATVDMQQKTWDTLGNFPSFYSFNHRGRA
LNPGYTPPE*

RE09053.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:03:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG15168-PA 109 CG15168-PA 1..109 1..109 566 100 Plus

RE09053.pep Sequence

Translation from 62 to 391

> RE09053.pep
MGSKLFNKLLLIAGFASLAHAAFSAAHHRTYLRLTEQEWNSLPLDIILQT
VISLVIVIYNIIEIVGNFKEIRATVDMQQKTWDTLGNFPSFYSFNHRGRA
LNPGYTPPE*

RE09053.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:59:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15260-PA 109 GF15260-PA 1..109 1..109 464 92.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:59:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21142-PA 109 GG21142-PA 1..109 1..109 572 98.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:59:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10173-PA 118 GH10173-PA 1..109 1..109 463 89.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG15168-PA 109 CG15168-PA 1..109 1..109 566 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:59:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14223-PA 117 GI14223-PA 1..109 1..109 463 90.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:59:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18500-PA 112 GL18500-PA 1..109 1..109 475 93.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:59:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13544-PA 112 GA13544-PA 1..109 1..109 475 93.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:59:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17305-PA 109 GM17305-PA 1..109 1..109 572 99.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:59:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24167-PA 109 GD24167-PA 1..109 1..109 578 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:59:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20508-PA 114 GJ20508-PA 1..109 1..109 460 90.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:59:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23889-PA 116 GK23889-PA 1..106 1..106 462 92.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:59:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13216-PA 109 GE13216-PA 1..109 1..109 572 98.2 Plus