BDGP Sequence Production Resources |
Search the DGRC for RE09053
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 90 |
Well: | 53 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG15168-RA |
Protein status: | RE09053.pep: gold |
Preliminary Size: | 330 |
Sequenced Size: | 488 |
Gene | Date | Evidence |
---|---|---|
CG15168 | 2001-12-14 | Blastp of sequenced clone |
CG15168 | 2002-01-01 | Sim4 clustering to Release 2 |
CG15168 | 2003-01-01 | Sim4 clustering to Release 3 |
CG15168 | 2008-04-29 | Release 5.5 accounting |
CG15168 | 2008-08-15 | Release 5.9 accounting |
CG15168 | 2008-12-18 | 5.12 accounting |
488 bp (488 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071004
> RE09053.complete TGAGCAAAATTTTGTAGAAAATTGTACCGACTGTGATTGTAATTCGTAAT TGTTCAATAAAAATGGGCAGTAAACTGTTTAACAAACTCTTGCTAATTGC CGGATTTGCCAGCCTGGCACATGCTGCTTTTTCTGCTGCCCATCATCGCA CCTATTTGAGGCTGACGGAGCAGGAATGGAATAGCCTTCCATTGGACATT ATCCTGCAGACCGTCATCAGTTTGGTGATTGTGATTTACAACATCATCGA GATCGTTGGCAACTTCAAGGAAATTCGCGCCACCGTGGACATGCAACAGA AAACTTGGGACACCTTGGGCAACTTCCCCTCGTTCTATTCCTTCAATCAC CGTGGTCGTGCCTTAAATCCTGGATATACGCCCCCGGAATAAGAGACCTT TCTTTTAAGTTCTGCTATCCTTTTATTTATAGTCTCAGCAAGTTACAATA TAGATAACGCTAAAGATCAACCAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 18986751..18987025 | 198..472 | 1375 | 100 | Plus |
chr2L | 23010047 | chr2L | 18986423..18986564 | 3..144 | 710 | 100 | Plus |
chr2L | 23010047 | chr2L | 18986630..18986682 | 145..197 | 265 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 18988057..18988334 | 198..475 | 1390 | 100 | Plus |
2L | 23513712 | 2L | 18987729..18987870 | 3..144 | 710 | 100 | Plus |
2L | 23513712 | 2L | 18987936..18987988 | 145..197 | 265 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 18988057..18988334 | 198..475 | 1390 | 100 | Plus |
2L | 23513712 | 2L | 18987729..18987870 | 3..144 | 710 | 100 | Plus |
2L | 23513712 | 2L | 18987936..18987988 | 145..197 | 265 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 18986421..18986564 | 1..144 | 99 | -> | Plus |
chr2L | 18986630..18986682 | 145..197 | 100 | -> | Plus |
chr2L | 18986751..18987025 | 198..472 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15168-RA | 1..330 | 63..392 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15168-RA | 1..330 | 63..392 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15168-RA | 1..330 | 63..392 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15168-RA | 1..330 | 63..392 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15168-RA | 1..330 | 63..392 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15168-RA | 1..431 | 1..431 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15168-RA | 1..472 | 1..472 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15168-RA | 21..492 | 1..472 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15168-RA | 1..431 | 1..431 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15168-RA | 21..492 | 1..472 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18987727..18987870 | 1..144 | 99 | -> | Plus |
2L | 18987936..18987988 | 145..197 | 100 | -> | Plus |
2L | 18988057..18988331 | 198..472 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18987727..18987870 | 1..144 | 99 | -> | Plus |
2L | 18987936..18987988 | 145..197 | 100 | -> | Plus |
2L | 18988057..18988331 | 198..472 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18987727..18987870 | 1..144 | 99 | -> | Plus |
2L | 18987936..18987988 | 145..197 | 100 | -> | Plus |
2L | 18988057..18988331 | 198..472 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 18987727..18987870 | 1..144 | 99 | -> | Plus |
arm_2L | 18987936..18987988 | 145..197 | 100 | -> | Plus |
arm_2L | 18988057..18988331 | 198..472 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18988057..18988331 | 198..472 | 100 | Plus | |
2L | 18987727..18987870 | 1..144 | 99 | -> | Plus |
2L | 18987936..18987988 | 145..197 | 100 | -> | Plus |
Translation from 62 to 391
> RE09053.hyp MGSKLFNKLLLIAGFASLAHAAFSAAHHRTYLRLTEQEWNSLPLDIILQT VISLVIVIYNIIEIVGNFKEIRATVDMQQKTWDTLGNFPSFYSFNHRGRA LNPGYTPPE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15168-PA | 109 | CG15168-PA | 1..109 | 1..109 | 566 | 100 | Plus |
Translation from 62 to 391
> RE09053.pep MGSKLFNKLLLIAGFASLAHAAFSAAHHRTYLRLTEQEWNSLPLDIILQT VISLVIVIYNIIEIVGNFKEIRATVDMQQKTWDTLGNFPSFYSFNHRGRA LNPGYTPPE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15260-PA | 109 | GF15260-PA | 1..109 | 1..109 | 464 | 92.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21142-PA | 109 | GG21142-PA | 1..109 | 1..109 | 572 | 98.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10173-PA | 118 | GH10173-PA | 1..109 | 1..109 | 463 | 89.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15168-PA | 109 | CG15168-PA | 1..109 | 1..109 | 566 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI14223-PA | 117 | GI14223-PA | 1..109 | 1..109 | 463 | 90.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18500-PA | 112 | GL18500-PA | 1..109 | 1..109 | 475 | 93.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13544-PA | 112 | GA13544-PA | 1..109 | 1..109 | 475 | 93.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17305-PA | 109 | GM17305-PA | 1..109 | 1..109 | 572 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24167-PA | 109 | GD24167-PA | 1..109 | 1..109 | 578 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20508-PA | 114 | GJ20508-PA | 1..109 | 1..109 | 460 | 90.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23889-PA | 116 | GK23889-PA | 1..106 | 1..106 | 462 | 92.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13216-PA | 109 | GE13216-PA | 1..109 | 1..109 | 572 | 98.2 | Plus |