Clone RE09091 Report

Search the DGRC for RE09091

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:90
Well:91
Vector:pFlc-1
Associated Gene/TranscriptmRpL46-RA
Protein status:RE09091.pep: gold
Sequenced Size:923

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13922 2001-12-14 Blastp of sequenced clone
CG13922 2002-01-01 Sim4 clustering to Release 2
CG13922 2003-01-01 Sim4 clustering to Release 3
mRpL46 2008-04-29 Release 5.5 accounting
mRpL46 2008-08-15 Release 5.9 accounting
mRpL46 2008-12-18 5.12 accounting

Clone Sequence Records

RE09091.complete Sequence

923 bp (923 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071006

> RE09091.complete
TGTTCCGGCTCTGGTGCTCATGTAATCGGTGGTCAACATTCTATTTTCCG
AAAAAATTAAATTAAACTGATTAAAATGCTGCGTCGCATTGTCCAAGTGG
GTGCCCGGGAGTTGAGCCGAGCCCAATCGTCAACCGCCAGCGCGGAAAAG
TGGGACCTGTACGCCGGAGTGCTCGTAGAGCGTCTCCCTGTGGTGTCCAA
GTCCCTTAATCCGCTGGAAAAACAGTTCCAAGACTTGCTATGGCGCGTGG
AGTACGAAAACAGCCTGAAGTCTGACCATGAACTCAAGCATGAACGTGAG
ATCGTCCAGGCGGAGCTCATAAAGCAGGGCAAGATCCAGGTGGACTTGGA
GGACGCAGGATCCAAGCAGACAGCTCAGGACCTCAAGGACGCCTACGTCG
AGGAGCTAAAAAAGTTCCAGTTGGGCTCCCGCACCACGCCCGATGACCAG
GCCAACAGAACCACCTCCACGGACCGCTGTCTGGATGACACGCTCTACCT
TTTGGTACAGCAGAAGCTGGGCCAGCAGGAGCACCTCATTCTACCGCAGG
GAAAGCGTGAGGAGGGAGAGTCCATGCGTCAGACTGCAGAAAGAGTGCTC
CGCGAGAGTTGCGGCCAGGAGCTGCAGGTTCTTTTCTACGGCAACGCCCC
AGTGGGCTTCCACAAATACAAGTATCCCAGAAACCAGCGGACGGAGACTG
TCGGAGCCAAGGTCTTCTTCTACAGAGCATCCCTGCGGTCCGGCCAGGTG
CCCGAAAATCTGACCAAGTTCGAGTGGCTTCCCAAGGAGGCGCTCAATGA
AAAGCTGACCAATACAGCCTATGCCCAAAGCGTTAAAAAGTTCTTGTTGT
AATCGTAATTGTTAAAATTGTTTTGATATCTAACAAATAAATAAAAATAC
TTCAGAGAAAAAAAAAAAAAAAA

RE09091.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:42:20
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL46-RA 907 mRpL46-RA 1..907 1..907 4535 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:35:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1777001..1777907 1..907 4535 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:31:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:35:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1777441..1778347 1..907 4535 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:09:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1777441..1778347 1..907 4535 100 Plus
Blast to na_te.dros performed 2019-03-16 21:35:05
Subject Length Description Subject Range Query Range Score Percent Strand
Tabor 7345 Tabor TABOR 7345bp 6458..6497 861..901 112 78 Plus

RE09091.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:36:07 Download gff for RE09091.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1777001..1777907 1..907 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:52:02 Download gff for RE09091.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL46-RA 1..777 76..852 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:08:03 Download gff for RE09091.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL46-RA 1..777 76..852 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:02:11 Download gff for RE09091.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL46-RA 1..777 76..852 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:32:20 Download gff for RE09091.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL46-RA 1..777 76..852 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:24:24 Download gff for RE09091.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL46-RA 1..777 76..852 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:36:50 Download gff for RE09091.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL46-RA 1..907 1..907 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:08:03 Download gff for RE09091.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL46-RA 1..907 1..907 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:02:11 Download gff for RE09091.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL46-RA 3..909 1..907 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:32:20 Download gff for RE09091.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL46-RA 1..907 1..907 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:24:24 Download gff for RE09091.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL46-RA 3..909 1..907 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:36:07 Download gff for RE09091.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1777441..1778347 1..907 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:36:07 Download gff for RE09091.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1777441..1778347 1..907 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:36:07 Download gff for RE09091.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1777441..1778347 1..907 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:02:11 Download gff for RE09091.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1777441..1778347 1..907 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:09:12 Download gff for RE09091.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1777441..1778347 1..907 100   Plus

RE09091.hyp Sequence

Translation from 75 to 851

> RE09091.hyp
MLRRIVQVGARELSRAQSSTASAEKWDLYAGVLVERLPVVSKSLNPLEKQ
FQDLLWRVEYENSLKSDHELKHEREIVQAELIKQGKIQVDLEDAGSKQTA
QDLKDAYVEELKKFQLGSRTTPDDQANRTTSTDRCLDDTLYLLVQQKLGQ
QEHLILPQGKREEGESMRQTAERVLRESCGQELQVLFYGNAPVGFHKYKY
PRNQRTETVGAKVFFYRASLRSGQVPENLTKFEWLPKEALNEKLTNTAYA
QSVKKFLL*

RE09091.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:25:59
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL46-PA 258 CG13922-PA 1..258 1..258 1314 100 Plus

RE09091.pep Sequence

Translation from 75 to 851

> RE09091.pep
MLRRIVQVGARELSRAQSSTASAEKWDLYAGVLVERLPVVSKSLNPLEKQ
FQDLLWRVEYENSLKSDHELKHEREIVQAELIKQGKIQVDLEDAGSKQTA
QDLKDAYVEELKKFQLGSRTTPDDQANRTTSTDRCLDDTLYLLVQQKLGQ
QEHLILPQGKREEGESMRQTAERVLRESCGQELQVLFYGNAPVGFHKYKY
PRNQRTETVGAKVFFYRASLRSGQVPENLTKFEWLPKEALNEKLTNTAYA
QSVKKFLL*

RE09091.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:59:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24835-PA 258 GF24835-PA 1..258 1..258 1189 85.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:59:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14823-PA 258 GG14823-PA 1..258 1..258 1283 92.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:59:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15718-PA 263 GH15718-PA 1..263 1..258 990 70.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:10
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL46-PA 258 CG13922-PA 1..258 1..258 1314 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:59:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12544-PA 262 GI12544-PA 1..262 1..258 1017 70.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:59:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16054-PA 261 GL16054-PA 1..261 1..258 1131 80.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:59:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12628-PA 261 GA12628-PA 1..261 1..258 1132 80.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:59:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14444-PA 258 GM14444-PA 1..258 1..258 1314 96.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:59:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13646-PA 228 GD13646-PA 6..228 21..258 1093 87.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16062-PA 94 GJ16062-PA 1..94 167..258 345 69.5 Plus
Dvir\GJ16061-PA 82 GJ16061-PA 1..80 1..78 290 68.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16633-PA 261 GK16633-PA 1..261 1..258 1072 74.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:59:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21186-PA 258 GE21186-PA 1..258 1..258 1291 93.8 Plus