Clone RE09173 Report

Search the DGRC for RE09173

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:91
Well:73
Vector:pFlc-1
Associated Gene/TranscriptCG5110-RA
Protein status:RE09173.pep: gold
Preliminary Size:375
Sequenced Size:550

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5110 2001-12-14 Blastp of sequenced clone
CG5110 2002-01-01 Sim4 clustering to Release 2
CG5110 2003-01-01 Sim4 clustering to Release 3
CG5110 2008-04-29 Release 5.5 accounting
CG5110 2008-08-15 Release 5.9 accounting
CG5110 2008-12-18 5.12 accounting

Clone Sequence Records

RE09173.complete Sequence

550 bp (550 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071010

> RE09173.complete
ACTTTGTTTTGTGTAAATAATTGGATGCGGAGAAAAACGTATTATTATTG
CCATACCTTCTCTAGTCTTTCGCTTTAACAAATTTTCCATGTCGGACGAC
ATCAAGAAGTATTTAGACGGCCTGCTGCAAAAGGTCAGCGGGCTGTACGT
TATTCAGATTACGGATCGCGACGGAGTGCCCCTCCTGCGGGTTAGCCAGG
AGAAGAACGTGGACTTCGCCCTGATGCCCTCGTTCATACCCACATTCACC
ACCGCCTGCGATCAGGCCAGCAAACTGGGATTGGGCAGAAACAAGACCAT
CATCTCCATGTACTCCAATTACCAGGTGGTCCAGATGAACAAGCTGCCGC
TCATCCTGACCTTTGTGGGCGCGGAGAACTGTAACACGGGACACATTCTC
GCACTGGAGCACCAGGTCGATGGCTATTTGGAGGACATTAAACAGGCTGT
CACCGAGGCCTAAAGTTAGTCTACCTTGTAATATGCATATTTTTAATATT
TACTAAATGTTTATACATACATACTTTATTGAGGAAAAAAAAAAAAAAAA

RE09173.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG5110-RA 732 CG5110-RA 26..558 1..533 2665 100 Plus
CG5110.a 569 CG5110.a 48..515 66..533 2340 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:06:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 17480059..17480463 129..533 2010 99.8 Plus
chr2L 23010047 chr2L 17479853..17479985 1..133 665 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:31:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:06:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17481452..17481856 129..533 2010 99.8 Plus
2L 23513712 2L 17481246..17481378 1..133 665 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:58:01
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17481452..17481856 129..533 2010 99.7 Plus
2L 23513712 2L 17481246..17481378 1..133 665 100 Plus
Blast to na_te.dros performed 2019-03-15 20:06:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 9522..9579 466..523 110 65.5 Plus
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 1005..1062 466..523 110 65.5 Plus

RE09173.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:07:08 Download gff for RE09173.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 17479853..17479984 1..132 100 -> Plus
chr2L 17480063..17480463 133..534 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:52:12 Download gff for RE09173.complete
Subject Subject Range Query Range Percent Splice Strand
CG5110-RA 1..375 89..463 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:48:43 Download gff for RE09173.complete
Subject Subject Range Query Range Percent Splice Strand
CG5110-RA 1..375 89..463 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:48:03 Download gff for RE09173.complete
Subject Subject Range Query Range Percent Splice Strand
CG5110-RA 1..375 89..463 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:40:06 Download gff for RE09173.complete
Subject Subject Range Query Range Percent Splice Strand
CG5110-RA 1..375 89..463 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:28:27 Download gff for RE09173.complete
Subject Subject Range Query Range Percent Splice Strand
CG5110-RA 1..375 89..463 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:01:11 Download gff for RE09173.complete
Subject Subject Range Query Range Percent Splice Strand
CG5110-RA 1..532 1..532 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:48:43 Download gff for RE09173.complete
Subject Subject Range Query Range Percent Splice Strand
CG5110-RA 1..532 1..532 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:48:03 Download gff for RE09173.complete
Subject Subject Range Query Range Percent Splice Strand
CG5110-RA 16..548 1..533 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:40:06 Download gff for RE09173.complete
Subject Subject Range Query Range Percent Splice Strand
CG5110-RA 1..532 1..532 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:28:27 Download gff for RE09173.complete
Subject Subject Range Query Range Percent Splice Strand
CG5110-RA 16..548 1..533 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:07:08 Download gff for RE09173.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17481246..17481377 1..132 100 -> Plus
2L 17481456..17481856 133..534 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:07:08 Download gff for RE09173.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17481246..17481377 1..132 100 -> Plus
2L 17481456..17481856 133..534 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:07:08 Download gff for RE09173.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17481246..17481377 1..132 100 -> Plus
2L 17481456..17481856 133..534 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:48:03 Download gff for RE09173.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17481246..17481377 1..132 100 -> Plus
arm_2L 17481456..17481856 133..534 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:10:29 Download gff for RE09173.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17481456..17481856 133..534 99   Plus
2L 17481246..17481377 1..132 100 -> Plus

RE09173.pep Sequence

Translation from 88 to 462

> RE09173.pep
MSDDIKKYLDGLLQKVSGLYVIQITDRDGVPLLRVSQEKNVDFALMPSFI
PTFTTACDQASKLGLGRNKTIISMYSNYQVVQMNKLPLILTFVGAENCNT
GHILALEHQVDGYLEDIKQAVTEA*

RE09173.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:28:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14799-PA 124 GF14799-PA 1..124 1..124 635 96 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:28:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21091-PA 124 GG21091-PA 1..124 1..124 649 99.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:28:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11622-PA 126 GH11622-PA 1..125 1..123 611 94.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG5110-PB 124 CG5110-PB 1..124 1..124 631 100 Plus
CG5110-PA 124 CG5110-PA 1..124 1..124 631 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:28:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17925-PA 126 GI17925-PA 1..125 1..123 587 91.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:28:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14499-PA 128 GL14499-PA 1..124 1..124 619 93.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:28:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18666-PA 128 GA18666-PA 1..124 1..124 619 93.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:28:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17242-PA 124 GM17242-PA 1..124 1..124 655 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:28:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24112-PA 124 GD24112-PA 1..124 1..124 655 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:29:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17698-PA 126 GJ17698-PA 1..125 1..123 615 95.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:29:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24182-PA 123 GK24182-PA 1..123 1..124 546 84.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:29:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12795-PA 124 GE12795-PA 1..124 1..124 651 99.2 Plus

RE09173.hyp Sequence

Translation from 88 to 462

> RE09173.hyp
MSDDIKKYLDGLLQKVSGLYVIQITDRDGVPLLRVSQEKNVDFALMPSFI
PTFTTACDQASKLGLGRNKTIISMYSNYQVVQMNKLPLILTFVGAENCNT
GHILALEHQVDGYLEDIKQAVTEA*

RE09173.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:04:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG5110-PB 124 CG5110-PB 1..124 1..124 631 100 Plus
CG5110-PA 124 CG5110-PA 1..124 1..124 631 100 Plus