BDGP Sequence Production Resources |
Search the DGRC for RE09173
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 91 |
Well: | 73 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG5110-RA |
Protein status: | RE09173.pep: gold |
Preliminary Size: | 375 |
Sequenced Size: | 550 |
Gene | Date | Evidence |
---|---|---|
CG5110 | 2001-12-14 | Blastp of sequenced clone |
CG5110 | 2002-01-01 | Sim4 clustering to Release 2 |
CG5110 | 2003-01-01 | Sim4 clustering to Release 3 |
CG5110 | 2008-04-29 | Release 5.5 accounting |
CG5110 | 2008-08-15 | Release 5.9 accounting |
CG5110 | 2008-12-18 | 5.12 accounting |
550 bp (550 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071010
> RE09173.complete ACTTTGTTTTGTGTAAATAATTGGATGCGGAGAAAAACGTATTATTATTG CCATACCTTCTCTAGTCTTTCGCTTTAACAAATTTTCCATGTCGGACGAC ATCAAGAAGTATTTAGACGGCCTGCTGCAAAAGGTCAGCGGGCTGTACGT TATTCAGATTACGGATCGCGACGGAGTGCCCCTCCTGCGGGTTAGCCAGG AGAAGAACGTGGACTTCGCCCTGATGCCCTCGTTCATACCCACATTCACC ACCGCCTGCGATCAGGCCAGCAAACTGGGATTGGGCAGAAACAAGACCAT CATCTCCATGTACTCCAATTACCAGGTGGTCCAGATGAACAAGCTGCCGC TCATCCTGACCTTTGTGGGCGCGGAGAACTGTAACACGGGACACATTCTC GCACTGGAGCACCAGGTCGATGGCTATTTGGAGGACATTAAACAGGCTGT CACCGAGGCCTAAAGTTAGTCTACCTTGTAATATGCATATTTTTAATATT TACTAAATGTTTATACATACATACTTTATTGAGGAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\Ulysses | 10653 | Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). | 9522..9579 | 466..523 | 110 | 65.5 | Plus |
Dvir\Ulysses | 10653 | Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). | 1005..1062 | 466..523 | 110 | 65.5 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 17479853..17479984 | 1..132 | 100 | -> | Plus |
chr2L | 17480063..17480463 | 133..534 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5110-RA | 1..375 | 89..463 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5110-RA | 1..375 | 89..463 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5110-RA | 1..375 | 89..463 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5110-RA | 1..375 | 89..463 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5110-RA | 1..375 | 89..463 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5110-RA | 1..532 | 1..532 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5110-RA | 1..532 | 1..532 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5110-RA | 16..548 | 1..533 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5110-RA | 1..532 | 1..532 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5110-RA | 16..548 | 1..533 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 17481246..17481377 | 1..132 | 100 | -> | Plus |
2L | 17481456..17481856 | 133..534 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 17481246..17481377 | 1..132 | 100 | -> | Plus |
2L | 17481456..17481856 | 133..534 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 17481246..17481377 | 1..132 | 100 | -> | Plus |
2L | 17481456..17481856 | 133..534 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 17481246..17481377 | 1..132 | 100 | -> | Plus |
arm_2L | 17481456..17481856 | 133..534 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 17481456..17481856 | 133..534 | 99 | Plus | |
2L | 17481246..17481377 | 1..132 | 100 | -> | Plus |
Translation from 88 to 462
> RE09173.pep MSDDIKKYLDGLLQKVSGLYVIQITDRDGVPLLRVSQEKNVDFALMPSFI PTFTTACDQASKLGLGRNKTIISMYSNYQVVQMNKLPLILTFVGAENCNT GHILALEHQVDGYLEDIKQAVTEA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14799-PA | 124 | GF14799-PA | 1..124 | 1..124 | 635 | 96 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21091-PA | 124 | GG21091-PA | 1..124 | 1..124 | 649 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11622-PA | 126 | GH11622-PA | 1..125 | 1..123 | 611 | 94.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5110-PB | 124 | CG5110-PB | 1..124 | 1..124 | 631 | 100 | Plus |
CG5110-PA | 124 | CG5110-PA | 1..124 | 1..124 | 631 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17925-PA | 126 | GI17925-PA | 1..125 | 1..123 | 587 | 91.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL14499-PA | 128 | GL14499-PA | 1..124 | 1..124 | 619 | 93.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18666-PA | 128 | GA18666-PA | 1..124 | 1..124 | 619 | 93.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17242-PA | 124 | GM17242-PA | 1..124 | 1..124 | 655 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24112-PA | 124 | GD24112-PA | 1..124 | 1..124 | 655 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17698-PA | 126 | GJ17698-PA | 1..125 | 1..123 | 615 | 95.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24182-PA | 123 | GK24182-PA | 1..123 | 1..124 | 546 | 84.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12795-PA | 124 | GE12795-PA | 1..124 | 1..124 | 651 | 99.2 | Plus |
Translation from 88 to 462
> RE09173.hyp MSDDIKKYLDGLLQKVSGLYVIQITDRDGVPLLRVSQEKNVDFALMPSFI PTFTTACDQASKLGLGRNKTIISMYSNYQVVQMNKLPLILTFVGAENCNT GHILALEHQVDGYLEDIKQAVTEA*