Clone RE09176 Report

Search the DGRC for RE09176

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:91
Well:76
Vector:pFlc-1
Associated Gene/TranscriptCG14818-RA
Protein status:RE09176.pep: gold
Sequenced Size:493

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14818 2001-12-14 Blastp of sequenced clone
CG14818 2002-01-01 Sim4 clustering to Release 2
CG14818 2008-04-29 Release 5.5 accounting
CG14818 2008-08-15 Release 5.9 accounting
CG14818 2008-12-18 5.12 accounting

Clone Sequence Records

RE09176.complete Sequence

493 bp (493 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071011

> RE09176.complete
ATCCCGTGACAATAAATCCAACTGGAAAAAACAAACGGAAAAACTCCGGG
GAAAATTCCAGGGAAAATGTCACCCAAAAACAATCATGATCCCTCGTCGT
CCGGCGACTCTGGCAACACCAATGTCCAGGAGGCGGACCTCCAAGAGATG
GAGGACGTGAACAACAGTCTGGACGCTCTCAGCTGTGCCCTGGACGCCGT
GGAGCAGCGCACAGACGACATTATGTCCCAACTACGGGAGCTGCTGAACT
CCAACCGAGAGATCCGTCGCCTGATTGCCGAGGAAAATGACAACGCTCCC
GAATCGGGAGATGACAACATGGACGGGCAGGCGGGCAGCGAAGCGGCACC
CAAGTAGATCCCTCTACGAGAAGTTATTGTTTTGTTCATCCAAATCGTTT
TTAGGCACAATCAGTGCTGTTTTTTTTCTATTATCATGTATTTTTGTCCT
AAGTCCTAAGTAAACGTAATTGAAAGCAAAAAAAAAAAAAAAA

RE09176.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:41:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG14818-RA 568 CG14818-RA 46..524 1..479 2395 100 Plus
CG14818.a 639 CG14818.a 122..600 1..479 2395 100 Plus
CG14818.b 814 CG14818.b 297..775 1..479 2395 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:50:43
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1772862..1773195 477..144 1670 100 Minus
chrX 22417052 chrX 1773255..1773399 145..1 725 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:31:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:50:41
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1879017..1879352 479..144 1680 100 Minus
X 23542271 X 1879412..1879556 145..1 725 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:08:10
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1887115..1887450 479..144 1680 100 Minus
X 23527363 X 1887510..1887654 145..1 725 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:50:41 has no hits.

RE09176.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:51:25 Download gff for RE09176.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1772862..1773193 146..477 100 <- Minus
chrX 1773255..1773399 1..145 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:52:13 Download gff for RE09176.complete
Subject Subject Range Query Range Percent Splice Strand
CG14818-RA 1..291 67..357 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:06:10 Download gff for RE09176.complete
Subject Subject Range Query Range Percent Splice Strand
CG14818-RA 1..291 67..357 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:51:32 Download gff for RE09176.complete
Subject Subject Range Query Range Percent Splice Strand
CG14818-RA 1..291 67..357 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:30:44 Download gff for RE09176.complete
Subject Subject Range Query Range Percent Splice Strand
CG14818-RA 1..291 67..357 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:41:31 Download gff for RE09176.complete
Subject Subject Range Query Range Percent Splice Strand
CG14818-RA 1..291 67..357 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:34:27 Download gff for RE09176.complete
Subject Subject Range Query Range Percent Splice Strand
CG14818-RA 27..503 1..477 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:06:09 Download gff for RE09176.complete
Subject Subject Range Query Range Percent Splice Strand
CG14818-RA 27..503 1..477 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:51:32 Download gff for RE09176.complete
Subject Subject Range Query Range Percent Splice Strand
CG14818-RA 25..501 1..477 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:30:44 Download gff for RE09176.complete
Subject Subject Range Query Range Percent Splice Strand
CG14818-RA 27..503 1..477 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:41:31 Download gff for RE09176.complete
Subject Subject Range Query Range Percent Splice Strand
CG14818-RA 25..501 1..477 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:51:25 Download gff for RE09176.complete
Subject Subject Range Query Range Percent Splice Strand
X 1879019..1879350 146..477 100 <- Minus
X 1879412..1879556 1..145 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:51:25 Download gff for RE09176.complete
Subject Subject Range Query Range Percent Splice Strand
X 1879019..1879350 146..477 100 <- Minus
X 1879412..1879556 1..145 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:51:25 Download gff for RE09176.complete
Subject Subject Range Query Range Percent Splice Strand
X 1879019..1879350 146..477 100 <- Minus
X 1879412..1879556 1..145 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:51:32 Download gff for RE09176.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1773052..1773383 146..477 100 <- Minus
arm_X 1773445..1773589 1..145 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:07:04 Download gff for RE09176.complete
Subject Subject Range Query Range Percent Splice Strand
X 1887117..1887448 146..477 100 <- Minus
X 1887510..1887654 1..145 100   Minus

RE09176.pep Sequence

Translation from 66 to 356

> RE09176.pep
MSPKNNHDPSSSGDSGNTNVQEADLQEMEDVNNSLDALSCALDAVEQRTD
DIMSQLRELLNSNREIRRLIAEENDNAPESGDDNMDGQAGSEAAPK*

RE09176.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19476-PA 99 GF19476-PA 1..93 1..87 364 80.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12673-PA 96 GG12673-PA 1..96 1..96 447 91.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24529-PA 99 GH24529-PA 1..96 1..88 328 69.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG14818-PB 96 CG14818-PB 1..96 1..96 489 100 Plus
CG14818-PA 96 CG14818-PA 1..96 1..96 489 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:45:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21609-PA 102 GI21609-PA 1..97 1..95 341 74.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:45:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18349-PA 98 GL18349-PA 1..90 1..88 336 76.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13271-PA 98 GA13271-PA 1..90 1..88 332 75.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18945-PA 95 GM18945-PA 1..95 1..96 450 94.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:45:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16409-PA 96 GD16409-PA 1..96 1..96 476 97.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:45:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16547-PA 105 GJ16547-PA 1..100 1..95 334 69 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:45:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16166-PA 103 GK16166-PA 1..93 1..87 358 78.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:45:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17000-PA 96 GE17000-PA 1..96 1..96 409 94.8 Plus

RE09176.hyp Sequence

Translation from 66 to 356

> RE09176.hyp
MSPKNNHDPSSSGDSGNTNVQEADLQEMEDVNNSLDALSCALDAVEQRTD
DIMSQLRELLNSNREIRRLIAEENDNAPESGDDNMDGQAGSEAAPK*

RE09176.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:19:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG14818-PB 96 CG14818-PB 1..96 1..96 489 100 Plus
CG14818-PA 96 CG14818-PA 1..96 1..96 489 100 Plus