Clone RE09212 Report

Search the DGRC for RE09212

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:92
Well:12
Vector:pFlc-1
Associated Gene/TranscriptEaf6-RA
Protein status:RE09212.pep: gold
Preliminary Size:678
Sequenced Size:821

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12756 2001-12-14 Blastp of sequenced clone
CG12756 2002-01-01 Sim4 clustering to Release 2
CG12756 2003-01-01 Sim4 clustering to Release 3
Eaf6 2008-04-29 Release 5.5 accounting
Eaf6 2008-08-15 Release 5.9 accounting
Eaf6 2008-12-18 5.12 accounting

Clone Sequence Records

RE09212.complete Sequence

821 bp (821 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071012

> RE09212.complete
TGGAAAATATGAGCTCGCCAACGAGTAAAAATGTCAGCGAAACGAACGGG
AACAAGCCAAAGAAGTCGGCCAAAACGAGCTCGAATACGAAAGGCGGCTC
CATGGACACTCGCGCCGAGTTGGCGGACCTCATCAAGAAGAAGGCCGAAA
CATCGGAACAACTGGCCAATCTGGAGCGACAGATCTACGCCTTCGAGGGC
TCCTACCTAGAGGACACGCAGTTGTGCGGAAACATCATCCGAGGCTGGGA
GCGCTATCTGACCTCCAACAAGGCCACCAACTCCAAGGCCGACAAGCGGA
ATCGCAAGTTCAAGGAGGCCGAGCGCCTGTTCTCCAAGTCCAGCATCACC
TCCATGGCTATATGCAATCCTGAGCGCGCCAGCGAATCGGATTCCATCAC
AAATGAAGACTCCAGCGACAATCAGATCTCAATCAATCAGAACACCACAA
CGGCCCACGACGGAACCACGACAATCAAGAGCACACCGAAAGACGAAAAG
GATTCACCCTCGCATCGCAATGAGGGCAGCGTAGTGAGCGGAATGGTGTC
TGGATCTACGAACAGTGGAGGGAACAAGGATCTCCTCGGCACACCCACTT
CGAATACAAAGAGCAAACTATCCACGAACTCCAGTGCGACAGCGAAGAAA
AGCGGTCACATAAACAAGAAGATTCGACATCGATGATAACTGCTACCGTG
TAATCCGCATCTGATAAAGCACTATTTACCTTCAAAGTTTTTAAATTAAA
ATTTGTACATGAAATAAAGCGAATGTAGATTTACAAACTTAGTTTATTTC
CATACAAAAAAAAAAAAAAAA

RE09212.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:40:21
Subject Length Description Subject Range Query Range Score Percent Strand
Eaf6-RA 1011 Eaf6-RA 150..955 3..808 4030 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:53:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 5599713..5600017 805..501 1510 99.7 Minus
chr3L 24539361 chr3L 5600380..5600594 369..155 1060 99.5 Minus
chr3L 24539361 chr3L 5600660..5600813 156..3 770 100 Minus
chr3L 24539361 chr3L 5600103..5600234 501..370 660 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:31:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:53:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5607159..5607466 808..501 1540 100 Minus
3L 28110227 3L 5607806..5608020 369..155 1075 100 Minus
3L 28110227 3L 5608086..5608239 156..3 770 100 Minus
3L 28110227 3L 5607552..5607683 501..370 660 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:07:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 5600259..5600566 808..501 1540 100 Minus
3L 28103327 3L 5600906..5601120 369..155 1075 100 Minus
3L 28103327 3L 5601186..5601339 156..3 770 100 Minus
3L 28103327 3L 5600652..5600783 501..370 660 100 Minus
Blast to na_te.dros performed on 2019-03-16 18:53:46 has no hits.

RE09212.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:55:08 Download gff for RE09212.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 5599713..5600016 502..805 99 <- Minus
chr3L 5600103..5600234 370..501 100 <- Minus
chr3L 5600380..5600593 156..369 99 <- Minus
chr3L 5600661..5600814 1..155 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:52:16 Download gff for RE09212.complete
Subject Subject Range Query Range Percent Splice Strand
Eaf6-RA 1..678 9..686 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:05:02 Download gff for RE09212.complete
Subject Subject Range Query Range Percent Splice Strand
Eaf6-RA 1..678 9..686 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:18:41 Download gff for RE09212.complete
Subject Subject Range Query Range Percent Splice Strand
Eaf6-RA 1..678 9..686 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:29:42 Download gff for RE09212.complete
Subject Subject Range Query Range Percent Splice Strand
Eaf6-RA 1..678 9..686 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:53:55 Download gff for RE09212.complete
Subject Subject Range Query Range Percent Splice Strand
Eaf6-RA 1..678 9..686 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:32:46 Download gff for RE09212.complete
Subject Subject Range Query Range Percent Splice Strand
Eaf6-RA 2..804 3..805 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:05:02 Download gff for RE09212.complete
Subject Subject Range Query Range Percent Splice Strand
Eaf6-RA 79..882 1..805 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:18:41 Download gff for RE09212.complete
Subject Subject Range Query Range Percent Splice Strand
Eaf6-RA 61..864 1..805 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:29:42 Download gff for RE09212.complete
Subject Subject Range Query Range Percent Splice Strand
Eaf6-RA 2..804 3..805 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:53:55 Download gff for RE09212.complete
Subject Subject Range Query Range Percent Splice Strand
Eaf6-RA 61..864 1..805 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:55:08 Download gff for RE09212.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5607162..5607465 502..805 100 <- Minus
3L 5607552..5607683 370..501 100 <- Minus
3L 5607806..5608019 156..369 100 <- Minus
3L 5608087..5608240 1..155 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:55:08 Download gff for RE09212.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5607162..5607465 502..805 100 <- Minus
3L 5607552..5607683 370..501 100 <- Minus
3L 5607806..5608019 156..369 100 <- Minus
3L 5608087..5608240 1..155 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:55:08 Download gff for RE09212.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5607162..5607465 502..805 100 <- Minus
3L 5607552..5607683 370..501 100 <- Minus
3L 5607806..5608019 156..369 100 <- Minus
3L 5608087..5608240 1..155 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:18:41 Download gff for RE09212.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5600262..5600565 502..805 100 <- Minus
arm_3L 5600652..5600783 370..501 100 <- Minus
arm_3L 5600906..5601119 156..369 100 <- Minus
arm_3L 5601187..5601340 1..155 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:05:47 Download gff for RE09212.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5600262..5600565 502..805 100 <- Minus
3L 5600652..5600783 370..501 100 <- Minus
3L 5600906..5601119 156..369 100 <- Minus
3L 5601187..5601340 1..155 99   Minus

RE09212.hyp Sequence

Translation from 2 to 685

> RE09212.hyp
ENMSSPTSKNVSETNGNKPKKSAKTSSNTKGGSMDTRAELADLIKKKAET
SEQLANLERQIYAFEGSYLEDTQLCGNIIRGWERYLTSNKATNSKADKRN
RKFKEAERLFSKSSITSMAICNPERASESDSITNEDSSDNQISINQNTTT
AHDGTTTIKSTPKDEKDSPSHRNEGSVVSGMVSGSTNSGGNKDLLGTPTS
NTKSKLSTNSSATAKKSGHINKKIRHR*

RE09212.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:26:18
Subject Length Description Subject Range Query Range Score Percent Strand
Eaf6-PA 225 CG12756-PA 1..225 3..227 1140 100 Plus

RE09212.pep Sequence

Translation from 8 to 685

> RE09212.pep
MSSPTSKNVSETNGNKPKKSAKTSSNTKGGSMDTRAELADLIKKKAETSE
QLANLERQIYAFEGSYLEDTQLCGNIIRGWERYLTSNKATNSKADKRNRK
FKEAERLFSKSSITSMAICNPERASESDSITNEDSSDNQISINQNTTTAH
DGTTTIKSTPKDEKDSPSHRNEGSVVSGMVSGSTNSGGNKDLLGTPTSNT
KSKLSTNSSATAKKSGHINKKIRHR*

RE09212.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:36:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10452-PA 232 GF10452-PA 1..232 1..225 928 86.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:36:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14120-PA 225 GG14120-PA 1..225 1..225 1145 97.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:36:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15014-PA 220 GH15014-PA 1..220 1..225 895 85.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:12
Subject Length Description Subject Range Query Range Score Percent Strand
Eaf6-PA 225 CG12756-PA 1..225 1..225 1140 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:36:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13176-PA 216 GI13176-PA 1..216 1..225 863 85 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:36:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11974-PA 219 GL11974-PA 1..172 1..172 849 93 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:36:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11793-PA 229 GA11793-PA 1..229 1..225 910 86.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:36:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13906-PA 225 GM13906-PA 1..225 1..225 1151 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13183-PA 225 GD13183-PA 1..225 1..225 1151 98.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11951-PA 219 GJ11951-PA 1..219 1..225 887 85.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:36:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17301-PA 225 GK17301-PA 1..225 1..225 958 89.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20544-PA 225 GE20544-PA 1..225 1..225 1084 96.9 Plus