Clone RE09259 Report

Search the DGRC for RE09259

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:92
Well:59
Vector:pFlc-1
Associated Gene/TranscriptCpr47Eg-RA
Protein status:RE09259.pep: gold
Preliminary Size:408
Sequenced Size:430

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9070 2001-12-17 Blastp of sequenced clone
CG9070 2002-01-01 Sim4 clustering to Release 2
CG9070 2003-01-01 Sim4 clustering to Release 3
Cpr47Eg 2008-04-29 Release 5.5 accounting
Cpr47Eg 2008-08-15 Release 5.9 accounting
Cpr47Eg 2008-12-18 5.12 accounting

Clone Sequence Records

RE09259.complete Sequence

430 bp (430 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071014

> RE09259.complete
ATCAGTTAGCCTTCTCAAGTCTTTCAACAATCAACATGAAGTTCTTCATT
GCTTTCGCCTGCCTGTTGGCCGTCGCCCTCGCCAACGAAGATGCCAATGT
TCTCCGTGCCGAGCAGCAAGTGAATGTTGACGGCTTTGCTTACGCTGTTG
AGCTGGACAACTCTGTCAATGTGCAACAGAAGGGTGACCTTAACGGCGAA
GAGTGGGTGGTGAAGGGAAGCCAGTCGTGGACATCTCCCGAAAATGTGCC
AGTGTCCATCCAATATATCGCCGATGCCAACGGTTACCAGGTGGTGTCTG
CCAACCCTCCTCTGCCCACCCCACCACCAATTCCAGAGGCCATCCAGCGT
TCTCTGGAGTACATCGCCGCCCACCCCCCAAGTCAATAAATAATGTTAAA
TAAATGTGTTGAACTTTAAAAAAAAAAAAA

RE09259.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:36:00
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr47Eg-RA 895 Cpr47Eg-RA 361..778 1..418 2090 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:48:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7165417..7165786 417..48 1850 100 Minus
chr2R 21145070 chr2R 7165855..7165901 47..1 235 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:31:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:48:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11277956..11278326 418..48 1855 100 Minus
2R 25286936 2R 11278395..11278441 47..1 235 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:03:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11279155..11279525 418..48 1855 100 Minus
2R 25260384 2R 11279594..11279640 47..1 235 100 Minus
Blast to na_te.dros performed on 2019-03-16 15:48:04 has no hits.

RE09259.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:49:04 Download gff for RE09259.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7165417..7165786 48..417 100 <- Minus
chr2R 7165855..7165901 1..47 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:52:18 Download gff for RE09259.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Eg-RA 1..354 36..389 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:58:52 Download gff for RE09259.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Eg-RA 1..354 36..389 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:19:08 Download gff for RE09259.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Eg-RA 1..354 36..389 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:23:37 Download gff for RE09259.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Eg-RA 1..354 36..389 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:48:49 Download gff for RE09259.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Eg-RA 1..354 36..389 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:24:11 Download gff for RE09259.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Eg-RA 1..417 1..417 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:58:52 Download gff for RE09259.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Eg-RA 1..417 1..417 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:19:08 Download gff for RE09259.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Eg-RA 5..421 1..417 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:23:37 Download gff for RE09259.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Eg-RA 1..417 1..417 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:48:49 Download gff for RE09259.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Eg-RA 5..421 1..417 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:49:04 Download gff for RE09259.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11277957..11278326 48..417 100 <- Minus
2R 11278395..11278441 1..47 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:49:04 Download gff for RE09259.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11277957..11278326 48..417 100 <- Minus
2R 11278395..11278441 1..47 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:49:04 Download gff for RE09259.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11277957..11278326 48..417 100 <- Minus
2R 11278395..11278441 1..47 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:19:08 Download gff for RE09259.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7165462..7165831 48..417 100 <- Minus
arm_2R 7165900..7165946 1..47 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:58:42 Download gff for RE09259.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11279156..11279525 48..417 100 <- Minus
2R 11279594..11279640 1..47 100   Minus

RE09259.hyp Sequence

Translation from 2 to 388

> RE09259.hyp
QLAFSSLSTINMKFFIAFACLLAVALANEDANVLRAEQQVNVDGFAYAVE
LDNSVNVQQKGDLNGEEWVVKGSQSWTSPENVPVSIQYIADANGYQVVSA
NPPLPTPPPIPEAIQRSLEYIAAHPPSQ*

RE09259.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:02:14
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr47Eg-PA 117 CG9070-PA 1..117 12..128 607 100 Plus
Cpr78Cc-PA 119 CG7658-PA 7..117 20..126 225 44.4 Plus
Cpr49Aa-PB 144 CG30045-PB 1..130 12..126 216 38.6 Plus
Lcp4-PB 112 CG2044-PB 2..112 14..128 205 42.2 Plus
Lcp4-PA 112 CG2044-PA 2..112 14..128 205 42.2 Plus

RE09259.pep Sequence

Translation from 35 to 388

> RE09259.pep
MKFFIAFACLLAVALANEDANVLRAEQQVNVDGFAYAVELDNSVNVQQKG
DLNGEEWVVKGSQSWTSPENVPVSIQYIADANGYQVVSANPPLPTPPPIP
EAIQRSLEYIAAHPPSQ*

RE09259.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:08:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12422-PA 118 GF12422-PA 1..115 1..115 424 77.4 Plus
Dana\GF10274-PA 119 GF10274-PA 23..119 17..117 210 49 Plus
Dana\GF12590-PA 130 GF12590-PA 2..123 3..116 198 40.2 Plus
Dana\GF11544-PA 92 GF11544-PA 1..86 1..85 195 46.5 Plus
Dana\GF12356-PA 112 GF12356-PA 17..112 17..117 184 43.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:08:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22680-PA 117 GG22680-PA 1..117 1..117 445 80.3 Plus
Dere\GG16171-PA 119 GG16171-PA 23..115 17..113 203 44.4 Plus
Dere\GG23356-PA 112 GG23356-PA 2..112 3..117 201 42.2 Plus
Dere\GG10645-PA 130 GG10645-PA 1..123 1..116 199 37.5 Plus
Dere\GG13245-PA 121 GG13245-PA 3..115 2..116 181 38 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:08:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21938-PA 121 GH21938-PA 1..118 1..117 309 60.2 Plus
Dgri\GH21954-PA 119 GH21954-PA 1..115 1..114 260 53.9 Plus
Dgri\GH20994-PA 124 GH20994-PA 2..117 3..114 215 43.8 Plus
Dgri\GH15299-PA 118 GH15299-PA 1..115 3..114 197 40.5 Plus
Dgri\GH20893-PA 265 GH20893-PA 151..261 4..117 185 37.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:57
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr47Eg-PA 117 CG9070-PA 1..117 1..117 607 100 Plus
Cpr78Cc-PA 119 CG7658-PA 7..117 9..115 225 44.4 Plus
Cpr49Aa-PB 144 CG30045-PB 1..130 1..115 216 38.6 Plus
Lcp4-PB 112 CG2044-PB 2..112 3..117 205 42.2 Plus
Lcp4-PA 112 CG2044-PA 2..112 3..117 205 42.2 Plus
Lcp1-PB 130 CG11650-PB 4..123 4..116 193 36 Plus
Lcp1-PA 130 CG11650-PA 4..123 4..116 193 36 Plus
Lcp2-PB 126 CG8697-PB 11..119 5..116 190 36.8 Plus
Lcp2-PA 126 CG8697-PA 11..119 5..116 190 36.8 Plus
Cpr67Fa2-PA 134 CG18349-PA 13..117 8..114 182 41.8 Plus
Cpr67Fa1-PA 134 CG7941-PA 13..117 8..114 182 41.8 Plus
Lcp9-PA 92 CG16914-PA 1..85 1..84 181 43.5 Plus
Lcp3-PB 112 CG2043-PB 2..109 3..114 181 40.7 Plus
Lcp3-PA 112 CG2043-PA 2..109 3..114 181 40.7 Plus
Edg78E-PB 122 CG7673-PB 7..115 9..116 180 37.1 Plus
Edg78E-PA 122 CG7673-PA 7..115 9..116 180 37.1 Plus
Cpr65Ea-PA 127 CG8640-PA 11..112 7..114 174 41.3 Plus
Cpr65Ec-PA 127 CG8634-PA 3..119 2..117 174 36.1 Plus
Cpr65Az-PA 239 CG12330-PA 112..211 18..112 174 40.2 Plus
Cpr49Ae-PA 134 CG8505-PA 7..132 9..117 171 35.2 Plus
Cpr67Fb-PA 122 CG18348-PA 8..114 5..114 164 33.9 Plus
Cpr78Cb-PB 140 CG7663-PB 55..128 34..113 155 45 Plus
Cpr78Cb-PA 140 CG7663-PA 55..128 34..113 155 45 Plus
Lcp65Ad-PB 108 CG6955-PB 1..106 1..94 154 38.7 Plus
Lcp65Ad-PA 108 CG6955-PA 1..106 1..94 154 38.7 Plus
Cpr49Af-PB 126 CG8510-PB 1..118 1..114 150 32.8 Plus
Cpr49Af-PA 126 CG8510-PA 1..118 1..114 150 32.8 Plus
Cpr65Ax2-PB 102 CG18777-PB 1..98 1..93 146 34.7 Plus
Cpr65Ax2-PA 102 CG18777-PA 1..98 1..93 146 34.7 Plus
Cpr65Ax1-PA 102 CG34270-PA 1..98 1..93 146 34.7 Plus
Cpr65Eb-PA 179 CG8638-PA 10..121 5..114 137 35.9 Plus
Cpr78Ca-PA 127 CG11310-PA 46..118 34..115 135 37.8 Plus
Cpr47Ea-PA 135 CG9079-PA 38..127 19..102 135 38 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:08:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19646-PA 120 GI19646-PA 1..114 1..114 306 60.5 Plus
Dmoj\GI20904-PA 119 GI20904-PA 2..116 3..116 237 45.8 Plus
Dmoj\GI20906-PA 117 GI20906-PA 6..115 3..117 237 45.2 Plus
Dmoj\GI20905-PA 121 GI20905-PA 2..116 3..116 226 45 Plus
Dmoj\GI18692-PA 144 GI18692-PA 41..132 20..116 214 49.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:08:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16747-PA 117 GL16747-PA 1..117 1..117 395 77.8 Plus
Dper\GL24679-PA 120 GL24679-PA 1..119 3..117 215 41.6 Plus
Dper\GL10863-PA 126 GL10863-PA 28..117 20..114 198 48.4 Plus
Dper\GL24678-PA 119 GL24678-PA 1..119 3..117 194 38.4 Plus
Dper\GL22414-PA 112 GL22414-PA 17..112 17..117 181 43.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:08:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21517-PA 117 GA21517-PA 1..117 1..117 396 77.8 Plus
Dpse\GA20507-PA 120 GA20507-PA 1..119 3..117 214 41.6 Plus
Dpse\GA24514-PA 138 GA24514-PA 2..127 1..114 196 39.7 Plus
Dpse\GA23947-PA 119 GA23947-PA 1..119 3..117 194 38.4 Plus
Dpse\GA21266-PA 126 GA21266-PA 28..117 20..114 189 46.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:08:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20458-PA 117 GM20458-PA 1..117 1..117 489 88 Plus
Dsec\GM22355-PA 120 GM22355-PA 23..118 17..116 214 47.1 Plus
Dsec\GM20690-PA 130 GM20690-PA 1..123 1..116 198 36.7 Plus
Dsec\GM21031-PA 112 GM21031-PA 2..112 3..117 196 42.2 Plus
Dsec\GM20688-PA 126 GM20688-PA 2..119 1..116 194 38.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:08:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25926-PA 117 GD25926-PA 1..117 1..117 458 84.6 Plus
Dsim\GD14949-PA 120 GD14949-PA 23..118 17..116 209 46.1 Plus
Dsim\GD10171-PA 130 GD10171-PA 1..123 1..116 200 37.5 Plus
Dsim\GD17593-PA 127 GD17593-PA 11..112 7..114 180 41.3 Plus
Dsim\GD12126-PA 122 GD12126-PA 3..115 2..116 180 37.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:08:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15011-PA 119 GJ15011-PA 1..117 1..116 371 70.1 Plus
Dvir\GJ20634-PA 126 GJ20634-PA 11..119 5..116 217 43 Plus
Dvir\GJ20637-PA 117 GJ20637-PA 2..112 3..114 203 44.8 Plus
Dvir\GJ20635-PA 117 GJ20635-PA 6..112 5..114 203 42.9 Plus
Dvir\GJ21708-PA 131 GJ21708-PA 33..124 20..116 202 45.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:08:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21625-PA 119 GK21625-PA 1..115 1..115 367 71.3 Plus
Dwil\GK21650-PA 91 GK21650-PA 1..86 1..85 233 50 Plus
Dwil\GK20466-PA 121 GK20466-PA 1..117 1..114 211 41.5 Plus
Dwil\GK21499-PA 114 GK21499-PA 17..109 17..114 193 45.9 Plus
Dwil\GK21815-PA 129 GK21815-PA 2..123 1..117 178 40.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:08:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13036-PA 117 GE13036-PA 1..117 1..117 431 80.3 Plus
Dyak\GE19198-PA 112 GE19198-PA 2..112 3..117 204 43.1 Plus
Dyak\GE23045-PA 130 GE23045-PA 1..121 1..114 200 37.3 Plus
Dyak\GE11415-PA 92 GE11415-PA 1..86 1..85 193 45.3 Plus
Dyak\GE19741-PA 119 GE19741-PA 1..117 3..115 189 43.1 Plus