Clone RE09339 Report

Search the DGRC for RE09339

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:93
Well:39
Vector:pFlc-1
Associated Gene/TranscriptPhk-3-RA
Protein status:RE09339.pep: gold
Preliminary Size:366
Sequenced Size:559

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9358 2001-12-14 Blastp of sequenced clone
CG9358 2002-01-01 Sim4 clustering to Release 2
CG9358 2003-01-01 Sim4 clustering to Release 3
Phk-3 2008-04-29 Release 5.5 accounting
Phk-3 2008-08-15 Release 5.9 accounting
Phk-3 2008-12-18 5.12 accounting

Clone Sequence Records

RE09339.complete Sequence

559 bp (559 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071015

> RE09339.complete
GCAATTTGAGTTGCGCCTTTGATCGTACCACAACTGCACCCGGGCCACCG
AAAATCACCGGAAGAGAAATAATCCTCCAAGATGAAAGCCTCGCTAGCTC
TAGTGTTCTGTGTTTGTGTCGGTCTTGCGGCAGCTGCTCCTGAAAAAACC
TACACCAACAAGTACGACAGTGTCAACGTGGATGAAGTTCTGGGCAACAA
CCGAGTGTTGGGTAATTATCTCAAGTGCCTGATGGACAAGGGCCCATGCA
CAGCAGAGGGTCGTGAACTTAAGCGCCTTTTACCCGACGCCCTTCATTCC
GACTGCTCAAAGTGCACGGAAGTCCAACGCAAAAACTCACAAAAGGTAAT
CAACTACCTTCGCGCCAACAAAGCCGGCGAATGGAAGCTCCTCCTGAACA
AGTACGATCCCCAAGGCATCTACAGAGCAAAGCACGAGGGACACTGAGCG
CTTTGCTTGTCCACCAAATGCACTAATTTCACATGAACCTAATTTAAACC
AGAGATCCACAGTAAAGATTTTAGTTTTTTATACCTAAATGCGAAAAAAA
AAAAAAAAA

RE09339.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:45:37
Subject Length Description Subject Range Query Range Score Percent Strand
Phk-3-RA 722 Phk-3-RA 176..722 1..547 2720 99.8 Plus
Phk-3.a 1024 Phk-3.a 478..1024 1..547 2720 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:13:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20856810..20857284 543..69 2375 100 Minus
chr2R 21145070 chr2R 20857742..20857809 68..1 340 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:31:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24970838..24971317 548..69 2385 99.8 Minus
2R 25286936 2R 24971775..24971842 68..1 340 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:06:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24972037..24972516 548..69 2385 99.7 Minus
2R 25260384 2R 24972974..24973041 68..1 340 100 Minus
Blast to na_te.dros performed on 2019-03-15 13:13:57 has no hits.

RE09339.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:14:54 Download gff for RE09339.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20856810..20857284 69..543 100 <- Minus
chr2R 20857742..20857809 1..68 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:52:24 Download gff for RE09339.complete
Subject Subject Range Query Range Percent Splice Strand
Phk-3-RA 1..366 82..447 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:39:45 Download gff for RE09339.complete
Subject Subject Range Query Range Percent Splice Strand
Phk-3-RA 1..366 82..447 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:59:23 Download gff for RE09339.complete
Subject Subject Range Query Range Percent Splice Strand
Phk-3-RA 1..366 82..447 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:16:57 Download gff for RE09339.complete
Subject Subject Range Query Range Percent Splice Strand
Phk-3-RA 1..366 82..447 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:25:10 Download gff for RE09339.complete
Subject Subject Range Query Range Percent Splice Strand
Phk-3-RA 1..366 82..447 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:44:49 Download gff for RE09339.complete
Subject Subject Range Query Range Percent Splice Strand
Phk-3-RA 1..543 1..543 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:39:45 Download gff for RE09339.complete
Subject Subject Range Query Range Percent Splice Strand
Phk-3-RA 1..543 1..543 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:59:23 Download gff for RE09339.complete
Subject Subject Range Query Range Percent Splice Strand
Phk-3-RA 4..546 1..543 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:16:57 Download gff for RE09339.complete
Subject Subject Range Query Range Percent Splice Strand
Phk-3-RA 1..543 1..543 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:25:10 Download gff for RE09339.complete
Subject Subject Range Query Range Percent Splice Strand
Phk-3-RA 4..546 1..543 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:14:54 Download gff for RE09339.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24970843..24971317 69..543 100 <- Minus
2R 24971775..24971842 1..68 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:14:54 Download gff for RE09339.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24970843..24971317 69..543 100 <- Minus
2R 24971775..24971842 1..68 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:14:54 Download gff for RE09339.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24970843..24971317 69..543 100 <- Minus
2R 24971775..24971842 1..68 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:59:23 Download gff for RE09339.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20858366..20858840 69..543 100 <- Minus
arm_2R 20859298..20859365 1..68 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:52:41 Download gff for RE09339.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24972060..24972534 69..543 100 <- Minus
2R 24972992..24973059 1..68 100   Minus

RE09339.pep Sequence

Translation from 81 to 446

> RE09339.pep
MKASLALVFCVCVGLAAAAPEKTYTNKYDSVNVDEVLGNNRVLGNYLKCL
MDKGPCTAEGRELKRLLPDALHSDCSKCTEVQRKNSQKVINYLRANKAGE
WKLLLNKYDPQGIYRAKHEGH*

RE09339.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:09:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11516-PA 127 GF11516-PA 1..121 1..120 502 76.9 Plus
Dana\GF12892-PA 126 GF12892-PA 1..118 5..121 330 49.2 Plus
Dana\GF20186-PA 965 GF20186-PA 905..958 66..119 141 44.4 Plus
Dana\GF12039-PA 112 GF12039-PA 11..110 4..109 136 28.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:09:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19868-PA 121 GG19868-PA 1..121 1..121 551 83.5 Plus
Dere\GG22923-PA 126 GG22923-PA 1..117 1..120 335 52.5 Plus
Dere\GG15834-PA 155 GG15834-PA 47..145 21..119 271 46.5 Plus
Dere\GG19963-PA 112 GG19963-PA 11..110 4..109 135 27.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:09:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22042-PA 122 GH22042-PA 1..121 1..121 512 76.9 Plus
Dgri\GH21706-PA 127 GH21706-PA 1..119 1..121 302 46 Plus
Dgri\GH12519-PA 132 GH12519-PA 15..111 24..120 268 47.4 Plus
Dgri\GH20166-PA 111 GH20166-PA 32..109 32..109 149 32.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:59
Subject Length Description Subject Range Query Range Score Percent Strand
Phk-3-PC 121 CG9358-PC 1..121 1..121 646 100 Plus
Phk-3-PB 121 CG9358-PB 1..121 1..121 646 100 Plus
Phk-3-PA 121 CG9358-PA 1..121 1..121 646 100 Plus
EbpIII-PC 126 CG11390-PC 1..111 1..114 334 57 Plus
EbpIII-PB 126 CG11390-PB 1..111 1..114 334 57 Plus
EbpIII-PA 126 CG11390-PA 1..111 1..114 334 57 Plus
a10-PA 155 CG6642-PA 47..145 21..119 270 46.5 Plus
CG30172-PB 112 CG30172-PB 30..110 29..109 142 30.9 Plus
CG30172-PA 112 CG30172-PA 30..110 29..109 142 30.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:09:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19129-PA 126 GI19129-PA 1..122 1..121 455 70.5 Plus
Dmoj\GI18859-PA 126 GI18859-PA 3..118 6..121 308 44.8 Plus
Dmoj\GI14872-PA 169 GI14872-PA 50..146 24..120 263 46.4 Plus
Dmoj\GI20684-PA 111 GI20684-PA 9..109 2..109 154 27.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:09:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10889-PA 125 GL10889-PA 1..119 1..120 477 75 Plus
Dper\GL11652-PA 126 GL11652-PA 16..118 19..121 306 51.5 Plus
Dper\GL15312-PA 149 GL15312-PA 15..138 3..118 264 41.1 Plus
Dper\GL15311-PA 68 GL15311-PA 2..57 63..118 143 46.4 Plus
Dper\GL10431-PA 112 GL10431-PA 33..110 32..109 131 28.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:09:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21727-PA 125 GA21727-PA 1..119 1..120 477 75 Plus
Dpse\GA10970-PA 126 GA10970-PA 16..118 19..121 306 51.5 Plus
Dpse\GA19747-PA 149 GA19747-PA 15..138 3..118 264 41.1 Plus
Dpse\GA15697-PA 112 GA15697-PA 33..110 32..109 131 28.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:09:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11771-PA 121 GM11771-PA 1..121 1..121 609 95.9 Plus
Dsec\GM18290-PA 126 GM18290-PA 18..115 21..118 308 56.1 Plus
Dsec\GM24353-PA 155 GM24353-PA 47..145 21..119 267 45.5 Plus
Dsec\GM18283-PA 112 GM18283-PA 11..110 4..109 135 27.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:09:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24902-PA 121 GD24902-PA 1..121 1..121 610 95.9 Plus
Dsim\GD11826-PA 126 GD11826-PA 18..115 21..118 320 58.2 Plus
Dsim\GD12430-PA 155 GD12430-PA 47..145 21..119 272 46.5 Plus
Dsim\GD24980-PA 112 GD24980-PA 11..110 4..109 135 27.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:09:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22262-PA 125 GJ22262-PA 1..122 1..121 494 75.4 Plus
Dvir\GJ20447-PA 126 GJ20447-PA 1..118 1..121 337 51.2 Plus
Dvir\GJ19536-PA 163 GJ19536-PA 39..139 19..119 268 45.5 Plus
Dvir\GJ20437-PA 111 GJ20437-PA 29..109 29..109 157 33.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:09:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19506-PA 127 GK19506-PA 1..122 1..121 449 73.8 Plus
Dwil\GK21931-PA 127 GK21931-PA 1..117 1..120 307 44.2 Plus
Dwil\GK24936-PA 171 GK24936-PA 51..146 24..119 265 49 Plus
Dwil\GK19383-PA 112 GK19383-PA 30..110 29..109 148 29.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:09:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Phk-3-PA 121 GE11392-PA 1..121 1..121 522 80.2 Plus
Dyak\PebIII-PA 126 GE14360-PA 1..117 1..120 333 51.7 Plus
Dyak\GE22174-PA 155 GE22174-PA 47..145 21..119 270 45.5 Plus
Dyak\GE11495-PA 112 GE11495-PA 11..110 4..109 136 27.4 Plus

RE09339.hyp Sequence

Translation from 81 to 446

> RE09339.hyp
MKASLALVFCVCVGLAAAAPEKTYTNKYDSVNVDEVLGNNRVLGNYLKCL
MDKGPCTAEGRELKRLLPDALHSDCSKCTEVQRKNSQKVINYLRANKAGE
WKLLLNKYDPQGIYRAKHEGH*

RE09339.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:15:21
Subject Length Description Subject Range Query Range Score Percent Strand
Phk-3-PC 121 CG9358-PC 1..121 1..121 646 100 Plus
Phk-3-PB 121 CG9358-PB 1..121 1..121 646 100 Plus
Phk-3-PA 121 CG9358-PA 1..121 1..121 646 100 Plus
PebIII-PC 126 CG11390-PC 1..111 1..114 334 57 Plus
PebIII-PB 126 CG11390-PB 1..111 1..114 334 57 Plus