Clone RE09466 Report

Search the DGRC for RE09466

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:94
Well:66
Vector:pFlc-1
Associated Gene/TranscriptCG1265-RB
Protein status:RE09466.pep: gold
Preliminary Size:567
Sequenced Size:838

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1265 2002-01-01 Sim4 clustering to Release 2
CG1265 2002-04-22 Blastp of sequenced clone
CG1265 2003-01-01 Sim4 clustering to Release 3
CG1265 2008-04-29 Release 5.5 accounting
CG1265 2008-08-15 Release 5.9 accounting
CG1265 2008-12-18 5.12 accounting

Clone Sequence Records

RE09466.complete Sequence

838 bp (838 high quality bases) assembled on 2002-04-22

GenBank Submission: AY113399

> RE09466.complete
AGACGCTGCAAATTTCGAATTTCGACGGTCGCTATGAGTGGAGCTCTCGG
AGATGTGGTGTCCGAATACCTGGAGCGCGGCCCAGTGCTCGTGGTGGCGG
ACCTCCTTAGCCTGATAACGGTCTCGTCCTGCCTGGTGATCAAGGTTCCG
CAGATAAACACGATACGGGCGAACGAGTCCTCGAAAGGCATCAGTGTTTT
GGGACTGTGCCTGGAGCTGTTCAGTTATACGGTGATGTTGTCGTACAACT
ACACCAGTGGCTACGACTTCCTCTCGTACATGGAGTATCCTGTTTTGCTG
CTGCAGGAGTACGCCCTGATTTACTACGCCTTCAAGTACCAGGATCTGCT
GGGAAGGAGGACGCAAGTGGTGGCCATACTGTATAGTATAGTGGCCACTC
TCATATACATGAAGCTCTTTCCCATTATCATCCTTAAGTTCCTGGTGCCT
TTCTGCACTCCCATTGGAGCCACGAGTAAGGTCCTCCAGCTGCTGGCTAT
TCTGAGGACCAAGGATGCCAGTTCCGTCAGTAGAACCACATGGGCGCTCT
CCGCCTTTACAAACATGACTCGAATCTACACGGTGTTCTTCCAGTCCCAC
GATTGGATGTTGCTATCAAACTTCCTGATTTCGACGTTCCTTAGCGCCTC
CGTTTTCACCGCCGCTTGCGTCTACAAGAAGAAGGCCAAGGCGGAGTAAT
TGGCCAGCCTGATTAGAAAAGCTCAACATAGACAAACACTGCGCTGGCTG
GAAATGCTTATCAGTCATTGTTTTAATTCTATTTGCTTATCTGTTTAAAT
TGATATTACAAATTCTTGTTCGAAAAAAAAAAAAAAAA

RE09466.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:13:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG1265-RB 1141 CG1265-RB 124..947 1..824 4090 99.7 Plus
CG1265.a 999 CG1265.a 24..470 1..447 2220 99.7 Plus
CG1265.a 999 CG1265.a 622..999 447..824 1875 99.7 Plus
CG15011-RA 2764 CG15011-RA 2660..2764 824..720 510 99 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:58:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4254420..4254681 186..447 1310 100 Plus
chr3L 24539361 chr3L 4255186..4255437 569..820 1260 100 Plus
chr3L 24539361 chr3L 4254168..4254355 1..188 925 99.5 Plus
chr3L 24539361 chr3L 4254995..4255116 447..568 610 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:31:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:58:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4255034..4255295 186..447 1310 100 Plus
3L 28110227 3L 4255800..4256055 569..824 1265 99.6 Plus
3L 28110227 3L 4254782..4254969 1..188 925 99.5 Plus
3L 28110227 3L 4255609..4255730 447..568 610 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:43:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4255034..4255295 186..447 1310 100 Plus
3L 28103327 3L 4255800..4256055 569..824 1265 99.6 Plus
3L 28103327 3L 4254782..4254969 1..188 925 99.4 Plus
3L 28103327 3L 4255609..4255730 447..568 610 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:58:19 has no hits.

RE09466.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:59:23 Download gff for RE09466.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4254996..4255116 448..568 100 -> Plus
chr3L 4254168..4254354 1..187 99 -> Plus
chr3L 4254422..4254681 188..447 100 -> Plus
chr3L 4255186..4255439 569..822 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:52:25 Download gff for RE09466.complete
Subject Subject Range Query Range Percent Splice Strand
CG1265-RB 1..666 34..699 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:59:14 Download gff for RE09466.complete
Subject Subject Range Query Range Percent Splice Strand
CG1265-RB 1..666 34..699 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:22:51 Download gff for RE09466.complete
Subject Subject Range Query Range Percent Splice Strand
CG1265-RB 1..666 34..699 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:52:33 Download gff for RE09466.complete
Subject Subject Range Query Range Percent Splice Strand
CG1265-RB 1..666 34..699 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:51:31 Download gff for RE09466.complete
Subject Subject Range Query Range Percent Splice Strand
CG1265-RB 1..666 34..699 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:39:53 Download gff for RE09466.complete
Subject Subject Range Query Range Percent Splice Strand
CG1265-RB 9..830 1..822 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:59:14 Download gff for RE09466.complete
Subject Subject Range Query Range Percent Splice Strand
CG1265-RB 9..830 1..822 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:22:51 Download gff for RE09466.complete
Subject Subject Range Query Range Percent Splice Strand
CG1265-RB 7..828 1..822 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:52:33 Download gff for RE09466.complete
Subject Subject Range Query Range Percent Splice Strand
CG1265-RB 9..830 1..822 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:51:31 Download gff for RE09466.complete
Subject Subject Range Query Range Percent Splice Strand
CG1265-RB 7..828 1..822 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:59:23 Download gff for RE09466.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4254782..4254968 1..187 99 -> Plus
3L 4255036..4255295 188..447 100 -> Plus
3L 4255610..4255730 448..568 100 -> Plus
3L 4255800..4256053 569..822 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:59:23 Download gff for RE09466.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4254782..4254968 1..187 99 -> Plus
3L 4255036..4255295 188..447 100 -> Plus
3L 4255610..4255730 448..568 100 -> Plus
3L 4255800..4256053 569..822 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:59:23 Download gff for RE09466.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4254782..4254968 1..187 99 -> Plus
3L 4255036..4255295 188..447 100 -> Plus
3L 4255610..4255730 448..568 100 -> Plus
3L 4255800..4256053 569..822 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:22:51 Download gff for RE09466.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4254782..4254968 1..187 99 -> Plus
arm_3L 4255036..4255295 188..447 100 -> Plus
arm_3L 4255610..4255730 448..568 100 -> Plus
arm_3L 4255800..4256053 569..822 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:24:38 Download gff for RE09466.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4255036..4255295 188..447 100 -> Plus
3L 4255610..4255730 448..568 100 -> Plus
3L 4255800..4256053 569..822 99   Plus
3L 4254782..4254968 1..187 99 -> Plus

RE09466.hyp Sequence

Translation from 0 to 698

> RE09466.hyp
RSCKFRISTVAMSGALGDVVSEYLERGPVLVVADLLSLITVSSCLVIKVP
QINTIRANESSKGISVLGLCLELFSYTVMLSYNYTSGYDFLSYMEYPVLL
LQEYALIYYAFKYQDLLGRRTQVVAILYSIVATLIYMKLFPIIILKFLVP
FCTPIGATSKVLQLLAILRTKDASSVSRTTWALSAFTNMTRIYTVFFQSH
DWMLLSNFLISTFLSASVFTAACVYKKKAKAE*

RE09466.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:55:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG1265-PB 221 CG1265-PB 1..221 12..232 1100 100 Plus
CG3792-PA 252 CG3792-PA 41..232 36..228 175 24.5 Plus

RE09466.pep Sequence

Translation from 33 to 698

> RE09466.pep
MSGALGDVVSEYLERGPVLVVADLLSLITVSSCLVIKVPQINTIRANESS
KGISVLGLCLELFSYTVMLSYNYTSGYDFLSYMEYPVLLLQEYALIYYAF
KYQDLLGRRTQVVAILYSIVATLIYMKLFPIIILKFLVPFCTPIGATSKV
LQLLAILRTKDASSVSRTTWALSAFTNMTRIYTVFFQSHDWMLLSNFLIS
TFLSASVFTAACVYKKKAKAE*

RE09466.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:32:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25055-PA 220 GF25055-PA 2..220 4..221 1036 90.4 Plus
Dana\GF15707-PA 253 GF15707-PA 41..232 25..217 154 25.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:32:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15210-PA 221 GG15210-PA 1..221 1..221 1125 98.2 Plus
Dere\GG25037-PA 252 GG25037-PA 41..236 25..220 150 26.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:32:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15935-PA 223 GH15935-PA 4..223 2..221 992 85 Plus
Dgri\GH13077-PA 253 GH13077-PA 41..235 25..220 162 27.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG1265-PB 221 CG1265-PB 1..221 1..221 1100 100 Plus
CG3792-PA 252 CG3792-PA 41..232 25..217 175 24.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:32:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16587-PA 226 GI16587-PA 7..224 2..219 986 86.2 Plus
Dmoj\GI21484-PA 254 GI21484-PA 41..232 25..217 163 25.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:32:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12841-PA 221 GL12841-PA 1..219 1..219 1011 87.7 Plus
Dper\GL26539-PA 252 GL26539-PA 41..232 25..217 158 25.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:32:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11737-PA 221 GA11737-PA 1..219 1..219 1013 88.1 Plus
Dpse\GA17688-PA 252 GA17688-PA 41..232 25..217 154 25.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:32:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14639-PA 221 GM14639-PA 1..221 1..221 1122 98.2 Plus
Dsec\GM18511-PA 252 GM18511-PA 41..232 25..217 150 25 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:32:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13827-PA 221 GD13827-PA 1..221 1..221 1123 97.7 Plus
Dsim\GD23315-PA 252 GD23315-PA 41..232 25..217 150 25 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:32:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12839-PA 226 GJ12839-PA 7..224 2..219 971 82.6 Plus
Dvir\GJ17483-PA 254 GJ17483-PA 41..232 25..217 157 26.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:32:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10552-PA 227 GK10552-PA 1..220 1..220 905 79.5 Plus
Dwil\GK24464-PA 251 GK24464-PA 41..232 25..217 153 25.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:32:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21429-PA 221 GE21429-PA 1..221 1..221 1122 97.7 Plus
Dyak\GE11282-PA 252 GE11282-PA 41..237 25..221 150 26.7 Plus