Clone RE09848 Report

Search the DGRC for RE09848

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:98
Well:48
Vector:pFlc-1
Associated Gene/TranscriptCG13014-RA
Protein status:RE09848.pep: gold
Preliminary Size:699
Sequenced Size:1035

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13014 2002-01-01 Sim4 clustering to Release 2
CG13014 2002-06-04 Blastp of sequenced clone
CG13014 2003-01-01 Sim4 clustering to Release 3
CG13014 2008-04-29 Release 5.5 accounting
CG13014 2008-08-15 Release 5.9 accounting
CG13014 2008-12-18 5.12 accounting

Clone Sequence Records

RE09848.complete Sequence

1035 bp (1035 high quality bases) assembled on 2002-06-04

GenBank Submission: AY118622

> RE09848.complete
AATATTGACGTAAATCTTGTTATTGTTTTGATGCAACAAATATTTAATAA
AGTTTAACTAAAGATCATTTATCCGCCGTTACATCGGCAACAAACTTGGT
CGAGGAATCAAGTCGCCCGTCCGCAAACTGGACGGAAGATTTGCCACCTT
GAGGTGGAATCACCGGCAACCGGCGTGATCGCTCTCAAGTCAAAACAATG
GTGTCCAACAGAAGTCCTCCTCCGAATCATGGTCCCTTGCCGGGGTCCAG
TGGTGGCACCTCCCTGCTAGCCCTGTGCCTGATCCACTTCGTCCTGGCCG
TGATCTCCGGCTGGGGTCTGAAACGGAGCACCGGCAGCAAGGCGATGGCC
GCCTTTGGGATCTACTTTGGCCACAGCCTGCTCTGCCTGCTGCGGCACAC
GCATCCCAATCCGGGCGCAGTGCAGCGTCTGCTGTGCGACAAGTCGAGAC
GTTACTCCTGCGTCCTATTTGTCACCCTGGTGGTGGGCGAGCTGCAGACC
GTAAATCCGGCCACCCGAATGGGTGACTTCTTCGGCGCCGACTGGGAGCG
TCTGGCCTTTGGACTGTGGAGCGCTGTACTGGCACTTGCAGTCACCAGCT
TGTGGTTCGGCAACAGTCGCAGTCCACTGGGTGCCACATTCATAAAACTG
GATGCCGCGCAATTGGGCCTCTGTGTTCTGTGGAATGTCCACTGTCTTTG
GCGCATCGCCATCGTCGACGAGCACTGGTGGTCACTTGGCCTGGCCCTGC
TTGTTCTGCTGAATCACTTTGTCCTGTGGCGACTGCCGCTGCACTACAAC
ATCAGCCAATTGGAGGTGGCCACCGTGGGCATGTGCTTTAGCACCATCTT
TGCGCTGAATGCCATCCAGGAGCAACTGGACGCTGTGGCCAGCTGAGAGT
AGCTGGTCGGGCAACCAGGGACTGGAGCCTTGATTGCCAAGCTCTAAGAC
ACCAACATTTAATTATAAGATGCACGTTGTTGAACAATTTTTTGAGTAAT
AAACCAGACTTCTTATTTCGAAAAAAAAAAAAAAA

RE09848.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:54:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG13014-RA 1026 CG13014-RA 1..1023 1..1023 5115 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:16:09
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16477580..16478599 1..1020 5010 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:32:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:16:07
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16587911..16588933 1..1023 5115 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:27:14
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 16596009..16597031 1..1023 5115 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:16:08 has no hits.

RE09848.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:16:56 Download gff for RE09848.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 16477580..16478599 1..1020 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:52:42 Download gff for RE09848.complete
Subject Subject Range Query Range Percent Splice Strand
CG13014-RA 1..699 198..896 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:32:35 Download gff for RE09848.complete
Subject Subject Range Query Range Percent Splice Strand
CG13014-RA 1..699 198..896 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:35:20 Download gff for RE09848.complete
Subject Subject Range Query Range Percent Splice Strand
CG13014-RA 1..699 198..896 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:23:06 Download gff for RE09848.complete
Subject Subject Range Query Range Percent Splice Strand
CG13014-RA 1..699 198..896 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:25:55 Download gff for RE09848.complete
Subject Subject Range Query Range Percent Splice Strand
CG13014-RA 1..699 198..896 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:03:05 Download gff for RE09848.complete
Subject Subject Range Query Range Percent Splice Strand
CG13014-RA 1..1020 1..1020 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:32:35 Download gff for RE09848.complete
Subject Subject Range Query Range Percent Splice Strand
CG13014-RA 1..1020 1..1020 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:35:20 Download gff for RE09848.complete
Subject Subject Range Query Range Percent Splice Strand
CG13014-RA 39..1058 1..1020 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:23:06 Download gff for RE09848.complete
Subject Subject Range Query Range Percent Splice Strand
CG13014-RA 1..1020 1..1020 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:25:55 Download gff for RE09848.complete
Subject Subject Range Query Range Percent Splice Strand
CG13014-RA 39..1058 1..1020 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:16:56 Download gff for RE09848.complete
Subject Subject Range Query Range Percent Splice Strand
X 16587911..16588930 1..1020 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:16:56 Download gff for RE09848.complete
Subject Subject Range Query Range Percent Splice Strand
X 16587911..16588930 1..1020 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:16:56 Download gff for RE09848.complete
Subject Subject Range Query Range Percent Splice Strand
X 16587911..16588930 1..1020 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:35:20 Download gff for RE09848.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16481944..16482963 1..1020 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:56:35 Download gff for RE09848.complete
Subject Subject Range Query Range Percent Splice Strand
X 16596009..16597028 1..1020 100   Plus

RE09848.pep Sequence

Translation from 197 to 895

> RE09848.pep
MVSNRSPPPNHGPLPGSSGGTSLLALCLIHFVLAVISGWGLKRSTGSKAM
AAFGIYFGHSLLCLLRHTHPNPGAVQRLLCDKSRRYSCVLFVTLVVGELQ
TVNPATRMGDFFGADWERLAFGLWSAVLALAVTSLWFGNSRSPLGATFIK
LDAAQLGLCVLWNVHCLWRIAIVDEHWWSLGLALLVLLNHFVLWRLPLHY
NISQLEVATVGMCFSTIFALNAIQEQLDAVAS*

RE09848.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:13:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20793-PA 233 GF20793-PA 1..228 1..232 881 77.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:13:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19055-PA 232 GG19055-PA 1..232 1..232 1155 96.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:13:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17669-PA 220 GH17669-PA 4..219 17..232 576 53 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG13014-PA 232 CG13014-PA 1..232 1..232 1233 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:13:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11132-PA 207 GI11132-PA 19..205 30..229 432 52.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:13:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19970-PA 232 GL19970-PA 35..230 24..228 724 67.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:13:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11976-PA 240 GA11976-PA 35..239 24..229 757 69.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:13:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13445-PA 232 GM13445-PA 1..232 1..232 1186 98.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:13:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17287-PA 232 GD17287-PA 1..232 1..232 1186 98.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:13:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19057-PA 219 GJ19057-PA 19..217 30..229 504 54.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:13:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25103-PA 228 GK25103-PA 7..227 16..232 607 53.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:13:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17277-PA 232 GE17277-PA 1..232 1..232 1114 96.1 Plus

RE09848.hyp Sequence

Translation from 197 to 895

> RE09848.hyp
MVSNRSPPPNHGPLPGSSGGTSLLALCLIHFVLAVISGWGLKRSTGSKAM
AAFGIYFGHSLLCLLRHTHPNPGAVQRLLCDKSRRYSCVLFVTLVVGELQ
TVNPATRMGDFFGADWERLAFGLWSAVLALAVTSLWFGNSRSPLGATFIK
LDAAQLGLCVLWNVHCLWRIAIVDEHWWSLGLALLVLLNHFVLWRLPLHY
NISQLEVATVGMCFSTIFALNAIQEQLDAVAS*

RE09848.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG13014-PA 232 CG13014-PA 1..232 1..232 1233 100 Plus