Clone RE10288 Report

Search the DGRC for RE10288

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:102
Well:88
Vector:pFlc-1
Associated Gene/TranscriptCG15554-RA
Protein status:RE10288.pep: gold
Preliminary Size:411
Sequenced Size:814

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15554 2002-01-01 Sim4 clustering to Release 2
CG15554 2002-06-10 Blastp of sequenced clone
CG15554 2003-01-01 Sim4 clustering to Release 3
CG15554 2008-04-29 Release 5.5 accounting
CG15554 2008-08-15 Release 5.9 accounting
CG15554 2008-12-18 5.12 accounting

Clone Sequence Records

RE10288.complete Sequence

814 bp (814 high quality bases) assembled on 2002-06-10

GenBank Submission: AY071020

> RE10288.complete
AGTTAGCTGCTGAGTTAACTGGAGATCGGTCGAAAATTTAGAGTGCGAAC
CTCGAAAACAACGTGTTGGATACGAATTTACGGACAATGTACAGGACTTT
TGTTTGGCTGTTAACCCTAATGGCAGTGGCAAGTGCCGCCACCTCGGGTC
GGGACTACTTGCCGCGCCCCCCCGCCAAAGCCTATGTCTACGGCACGCCC
CCGCCCAGCACGATGGCTCAGTTGCGACGGATAATCCAAGGTCACCTGGA
GCGCTTCCAGCTGGCGGAGCAGGCCCACTTTTCCCGCCGCGCCAATGTGC
AGCTGGGGAAATCGGAAGTGCCGGCGGACAGAAAACCGCTGGCGATGCAA
TTGTGGGTGGTTCGCACGCCCGCCATTTCCGGCGCGGCCTCGGATAACGT
CCTCGATTACGCCCTGCCGCCCAACACGCCCACTCCGAAGGACTACGCGC
ACAAGTTCCTGCCCGAGGGCAAGGATGTGGTACCCGGAAGCTCTTACATA
CCGCTGCGGTTGCTGGTGATAAAGCGCTGAAGCTGATATATGAATCTTGG
GCGGCGGCTTGCCTTTTGTTGTTCGAAAACAAGTTCCGGCGGAATGCCGA
TACCCGACACTTAATGCCCAACCAGTAGTTGGCTAATTGGCTTTAAGCTT
ACTGGTTCCTAGCGCTAGTCTAGCAATAGTTTAGTTGTTTATGTTAAGGC
CCAAGTTCGCTAATCTAAATTAAGCCACCACATCCCGGGGTCCGTGACTA
AGACTTCCGACCTTATCGCATCCAATAAATCCAAAACTAAGACTCAGCCA
AAAAAAAAAAAAAA

RE10288.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:49:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG15554-RA 941 CG15554-RA 107..906 1..800 3985 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:55:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26949033..26949725 107..799 3420 99.6 Plus
chr3R 27901430 chr3R 26948541..26948647 1..107 520 99.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:32:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:55:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 31126643..31127336 107..800 3470 100 Plus
3R 32079331 3R 31126151..31126257 1..107 520 99.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:22:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 30867474..30868167 107..800 3470 100 Plus
3R 31820162 3R 30866982..30867088 1..107 520 99 Plus
Blast to na_te.dros performed on 2019-03-16 02:55:04 has no hits.

RE10288.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:55:58 Download gff for RE10288.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26948541..26948647 1..107 99 -> Plus
chr3R 26949034..26949725 108..799 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:53:04 Download gff for RE10288.complete
Subject Subject Range Query Range Percent Splice Strand
CG15554-RA 1..444 87..530 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:25:03 Download gff for RE10288.complete
Subject Subject Range Query Range Percent Splice Strand
CG15554-RA 1..444 87..530 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:15:04 Download gff for RE10288.complete
Subject Subject Range Query Range Percent Splice Strand
CG15554-RA 1..444 87..530 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:15:37 Download gff for RE10288.complete
Subject Subject Range Query Range Percent Splice Strand
CG15554-RA 1..444 87..530 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:24:54 Download gff for RE10288.complete
Subject Subject Range Query Range Percent Splice Strand
CG15554-RA 1..444 87..530 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:52:45 Download gff for RE10288.complete
Subject Subject Range Query Range Percent Splice Strand
CG15554-RA 1..799 1..799 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:25:03 Download gff for RE10288.complete
Subject Subject Range Query Range Percent Splice Strand
CG15554-RA 1..799 1..799 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:15:04 Download gff for RE10288.complete
Subject Subject Range Query Range Percent Splice Strand
CG15554-RA 1..799 1..799 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:15:37 Download gff for RE10288.complete
Subject Subject Range Query Range Percent Splice Strand
CG15554-RA 1..799 1..799 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:24:54 Download gff for RE10288.complete
Subject Subject Range Query Range Percent Splice Strand
CG15554-RA 3..801 1..799 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:55:58 Download gff for RE10288.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31126151..31126257 1..107 99 -> Plus
3R 31126644..31127335 108..799 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:55:58 Download gff for RE10288.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31126151..31126257 1..107 99 -> Plus
3R 31126644..31127335 108..799 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:55:58 Download gff for RE10288.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31126151..31126257 1..107 99 -> Plus
3R 31126644..31127335 108..799 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:15:04 Download gff for RE10288.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26951873..26951979 1..107 99 -> Plus
arm_3R 26952366..26953057 108..799 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:48:44 Download gff for RE10288.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30867475..30868166 108..799 100   Plus
3R 30866982..30867088 1..107 99 -> Plus

RE10288.pep Sequence

Translation from 86 to 529

> RE10288.pep
MYRTFVWLLTLMAVASAATSGRDYLPRPPAKAYVYGTPPPSTMAQLRRII
QGHLERFQLAEQAHFSRRANVQLGKSEVPADRKPLAMQLWVVRTPAISGA
ASDNVLDYALPPNTPTPKDYAHKFLPEGKDVVPGSSYIPLRLLVIKR*

RE10288.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:38:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18415-PA 146 GF18415-PA 1..146 1..147 536 70.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:38:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11791-PA 147 GG11791-PA 1..147 1..147 725 93.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:38:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13974-PA 131 GH13974-PA 1..129 1..146 269 42.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:28:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG15554-PA 147 CG15554-PA 1..147 1..147 764 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:38:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22318-PA 143 GI22318-PA 3..143 1..147 265 42.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:38:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13539-PA 141 GL13539-PA 1..141 1..147 427 61.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:38:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13812-PA 141 GA13812-PA 1..141 1..147 427 61.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:38:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12921-PA 147 GM12921-PA 1..147 1..147 733 95.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:38:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21560-PA 147 GD21560-PA 1..147 1..147 745 96.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:38:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10505-PA 142 GJ10505-PA 1..142 1..147 314 48.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:38:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22613-PA 148 GK22613-PA 1..148 1..147 335 57.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:38:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10919-PA 147 GE10919-PA 1..147 1..147 732 93.9 Plus

RE10288.hyp Sequence

Translation from 86 to 529

> RE10288.hyp
MYRTFVWLLTLMAVASAATSGRDYLPRPPAKAYVYGTPPPSTMAQLRRII
QGHLERFQLAEQAHFSRRANVQLGKSEVPADRKPLAMQLWVVRTPAISGA
ASDNVLDYALPPNTPTPKDYAHKFLPEGKDVVPGSSYIPLRLLVIKR*

RE10288.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:48:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG15554-PA 147 CG15554-PA 1..147 1..147 764 100 Plus