Clone RE10350 Report

Search the DGRC for RE10350

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:103
Well:50
Vector:pFlc-1
Associated Gene/TranscriptCG33695-RC
Protein status:RE10350.pep: gold
Sequenced Size:1306

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32955 2005-01-26 Blastp of sequenced clone
CG33695 2008-04-29 Release 5.5 accounting
CG33695 2008-08-15 Release 5.9 accounting
cana 2008-08-15 Release 5.9 accounting
CG33695 2008-12-18 5.12 accounting
cana 2008-12-18 5.12 accounting

Clone Sequence Records

RE10350.complete Sequence

1306 bp (1306 high quality bases) assembled on 2005-01-26

GenBank Submission: BT021320

> RE10350.complete
TGTGTTGTGTACGGCGTCAGTGTTGAATAGCTGCGGACGCAAAACTACGT
AAAATTACGACAAAAAAACAGCGCCCCGCGAAAAAAGGCCATGAACTCGG
CAATCAAGGTGGGGGAGATATTCACGGCCGCCGGACAGGCGTTCAGCAGA
CTGGGCGATCTAACCATGCAGCTGCATCCCAATGCGGAGTCGCCATCGGG
TTCTCAGATCCGCCAGGCGCTGAAGAAGAAGGCCTTCGAGGACGCCGGCA
TTCCCGCCAAGCAAGTGCCCGTCCAGCAGGTGCAACACGTTCTCCAGACG
CTGCCACAACAGCAGCCGCAGCAGCCCCTTCAGCAGCCACCTCCTCAAGT
ATTCAAGTCACAGCCAATCGTGCAGCACGTACAGCTGGTGGCGCAGCCAA
AGCAGATCATCCTGCATCCACAGTCTAATACAACTACGACGGGCACGACG
GTGACTGTTAAGCAGTACCAGCAGATGCAGAAGGCTGCGGCATTAGCGGC
AGCCCAGGCTGCAGCCTCGACGGCCAACAACACGCCCACCATCACGGAGA
ACATCATTATCCAGCAGCCCACTTCGACTACGGCGACAGTGGTGCAGCAG
CCACATATGGTGTCCACCTGCTCGTCGACGCAGATCGTGGTGCCCGTTGT
GTCGGCAGTGTCCACTGTTCCAACAGTACTCTCGCCCACGGTGGTGATTG
CCGACGATGTGGTTAGCACCTCCAATCCTCCAGCGGCAGCGGCGACAGTA
GGATCGCCAGCAGGGGCGCCAGCAGGCTTAAAGTGCGGACCAGACGTGTC
CATGACCCTCAATCGCATCAATGTCCAGGAGAACGAGGTGGACGTGGAGG
AGTGCCTGCCCGCAGAGGTGGTCAAGCTGGATTTTGTCAGCGAGGAGGTG
GCCGGGTGAGGTTCGAGCCCTCGGAACGGGCTGGACTTCTTCTACTAGAT
CTCCGGCCGCAGAACGAATCACGTAACTTGGAACAGAACCGCTACAAATC
CAGATCGAGAACTCTTAAGCAAAAAGGTTGAGATGCCGCCCTAGCCCTAA
GTCTAAACTGTTAAGTGTTGTCATATTTGATATACCCTGAAATCACCTTG
TTCCGGGCCCCGGATGACAAATGAATTGTGCGATGTGGGGGACGAGTCTG
TGGATCGCCAGCCACAGAGCGTAGATATTAATTGCGGAGCGTATATGCGC
CGCCTAGACTTAAATTTACGCAAGACACAATAGTGCAAAGTACATAACGA
CGATCGTGTAAGTTGAGAGTGAATAAACGAGCATTATTTTAAAAAAAAAA
AAAAAA

RE10350.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:44:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG33695-RC 1293 CG33695-RC 2..1292 2..1292 6440 99.9 Plus
cana-RA 7987 cana-RA 6895..7986 201..1292 5445 99.9 Plus
CG33695-RA 7987 CG33695-RA 6895..7986 201..1292 5445 99.9 Plus
cana-RA 7987 cana-RA 6597..6795 2..200 995 100 Plus
CG33695-RA 7987 CG33695-RA 6597..6795 2..200 995 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:55:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 11277492..11278582 200..1290 5395 99.6 Plus
chr2L 23010047 chr2L 11276762..11276870 2..110 545 100 Plus
chr2L 23010047 chr2L 11277130..11277223 107..200 470 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:32:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11278754..11279846 200..1292 5450 99.9 Plus
2L 23513712 2L 11278024..11278132 2..110 545 100 Plus
2L 23513712 2L 11278392..11278485 107..200 470 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:34:31
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11278754..11279846 200..1292 5450 99.9 Plus
2L 23513712 2L 11278024..11278132 2..110 545 100 Plus
2L 23513712 2L 11278392..11278485 107..200 470 100 Plus
Blast to na_te.dros performed 2019-03-16 02:55:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..7028 275..581 198 55.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6809..6939 274..404 169 58.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6724..6941 300..518 163 58.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2310..2373 274..337 140 68.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6761..6827 274..340 137 67.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2787..2860 274..347 136 64.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2310..2602 295..605 135 54 Plus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 92..194 237..337 132 60.2 Plus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 9122..9224 237..337 132 60.2 Plus
roo 9092 roo DM_ROO 9092bp 1067..1108 295..336 129 78.6 Plus
roo 9092 roo DM_ROO 9092bp 1091..1168 274..350 126 64.1 Plus

RE10350.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:56:03 Download gff for RE10350.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 11276761..11276868 1..108 99 -> Plus
chr2L 11277132..11277223 109..200 100 -> Plus
chr2L 11277493..11278582 201..1290 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:53:07 Download gff for RE10350.complete
Subject Subject Range Query Range Percent Splice Strand
CG33695-RC 1..819 91..909 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:13:19 Download gff for RE10350.complete
Subject Subject Range Query Range Percent Splice Strand
CG33695-RC 1..819 91..909 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:15:07 Download gff for RE10350.complete
Subject Subject Range Query Range Percent Splice Strand
CG33695-RC 1..819 91..909 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:57:48 Download gff for RE10350.complete
Subject Subject Range Query Range Percent Splice Strand
CG33695-RC 1..819 91..909 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:25:05 Download gff for RE10350.complete
Subject Subject Range Query Range Percent Splice Strand
CG33695-RC 1..819 91..909 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:09:27 Download gff for RE10350.complete
Subject Subject Range Query Range Percent Splice Strand
CG33695-RC 2..1290 2..1290 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:13:19 Download gff for RE10350.complete
Subject Subject Range Query Range Percent Splice Strand
CG33695-RC 2..1290 2..1290 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:15:07 Download gff for RE10350.complete
Subject Subject Range Query Range Percent Splice Strand
CG33695-RC 3..1292 1..1290 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:57:48 Download gff for RE10350.complete
Subject Subject Range Query Range Percent Splice Strand
CG33695-RC 2..1290 2..1290 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:25:05 Download gff for RE10350.complete
Subject Subject Range Query Range Percent Splice Strand
CG33695-RC 3..1292 1..1290 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:56:03 Download gff for RE10350.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11278023..11278130 1..108 99 -> Plus
2L 11278394..11278485 109..200 100 -> Plus
2L 11278755..11279844 201..1290 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:56:03 Download gff for RE10350.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11278023..11278130 1..108 99 -> Plus
2L 11278394..11278485 109..200 100 -> Plus
2L 11278755..11279844 201..1290 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:56:03 Download gff for RE10350.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11278023..11278130 1..108 99 -> Plus
2L 11278394..11278485 109..200 100 -> Plus
2L 11278755..11279844 201..1290 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:15:07 Download gff for RE10350.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11278023..11278130 1..108 99 -> Plus
arm_2L 11278394..11278485 109..200 100 -> Plus
arm_2L 11278755..11279844 201..1290 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:33:16 Download gff for RE10350.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11278755..11279844 201..1290 99   Plus
2L 11278023..11278130 1..108 99 -> Plus
2L 11278394..11278485 109..200 100 -> Plus

RE10350.pep Sequence

Translation from 90 to 908

> RE10350.pep
MNSAIKVGEIFTAAGQAFSRLGDLTMQLHPNAESPSGSQIRQALKKKAFE
DAGIPAKQVPVQQVQHVLQTLPQQQPQQPLQQPPPQVFKSQPIVQHVQLV
AQPKQIILHPQSNTTTTGTTVTVKQYQQMQKAAALAAAQAAASTANNTPT
ITENIIIQQPTSTTATVVQQPHMVSTCSSTQIVVPVVSAVSTVPTVLSPT
VVIADDVVSTSNPPAAAATVGSPAGAPAGLKCGPDVSMTLNRINVQENEV
DVEECLPAEVVKLDFVSEEVAG*

RE10350.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:00:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14768-PA 321 GF14768-PA 1..321 1..272 650 60.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:00:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23716-PA 304 GG23716-PA 1..304 1..272 915 86.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:00:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13390-PA 287 GH13390-PA 1..287 1..272 559 56.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG33695-PC 272 CG33695-PC 1..272 1..272 1357 100 Plus
CG33695-PD 274 CG33695-PD 7..274 5..272 1332 99.3 Plus
CG33695-PE 305 CG33695-PE 1..305 1..272 1313 89.2 Plus
CG33695-PF 280 CG33695-PF 1..280 26..272 1192 88.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:00:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20672-PA 311 GI20672-PA 1..90 1..57 260 62.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:00:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19553-PA 309 GL19553-PA 1..309 1..272 573 56.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:00:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26007-PA 308 GA26007-PA 1..308 1..272 616 58.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:01:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18984-PA 304 GM18984-PA 1..304 1..272 911 87.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:01:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23773-PA 304 GD23773-PA 1..304 1..272 913 87.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:01:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13267-PA 295 GJ13267-PA 1..295 1..272 516 54.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:01:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14901-PA 309 GK14901-PA 1..309 1..272 540 53.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:01:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18521-PA 304 GE18521-PA 1..304 1..272 898 86.2 Plus

RE10350.hyp Sequence

Translation from 90 to 908

> RE10350.hyp
MNSAIKVGEIFTAAGQAFSRLGDLTMQLHPNAESPSGSQIRQALKKKAFE
DAGIPAKQVPVQQVQHVLQTLPQQQPQQPLQQPPPQVFKSQPIVQHVQLV
AQPKQIILHPQSNTTTTGTTVTVKQYQQMQKAAALAAAQAAASTANNTPT
ITENIIIQQPTSTTATVVQQPHMVSTCSSTQIVVPVVSAVSTVPTVLSPT
VVIADDVVSTSNPPAAAATVGSPAGAPAGLKCGPDVSMTLNRINVQENEV
DVEECLPAEVVKLDFVSEEVAG*

RE10350.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:22:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG33695-PC 272 CG33695-PC 1..272 1..272 1357 100 Plus
CG33695-PD 274 CG33695-PD 7..274 5..272 1332 99.3 Plus
CG33695-PE 305 CG33695-PE 1..305 1..272 1313 89.2 Plus
CG33695-PF 280 CG33695-PF 1..280 26..272 1192 88.2 Plus