RE10554.complete Sequence
602 bp (602 high quality bases) assembled on 2001-12-16
GenBank Submission: AY075451
> RE10554.complete
CTCTTTTCCCTTTTTCTTTTGAATAGCATTTGGTTGCACGTTTCCTCTGT
GACGCCGCCATTATGCAGATCTTCGTGAAAACCCTCACCGGCAAGACCAT
CACCTTGGAGGTGGAGCCTTCTGACACCATCGAGAATGTCAAGGCTAAGA
TCCAGGATAAGGAGGGCATTCCCCCAGATCAGCAGCGTCTGATCTTCGCC
GGCAAGCAGCTGGAGGATGGCCGCACTCTGTCCGACTACAACATTCAGAA
GGAGTCCACCCTGCACTTGGTGCTCCGCCTGCGTGGTGGTATCATTGAGC
CCTCGCTCAGGATTCTGGCCCAGAAGTACAACTGCGACAAGATGATCTGC
CGCAAGTGCTACGCCCGTCTGCATCCTCGTGCCACCAACTGCCGCAAGAA
GAAGTGCGGACACACCAACAACCTGCGCCCCAAGAAGAAGTTGAAGTAGA
CTATGATCATCCGTCGACGGTCCAGGCTGGTCTTTCTATCGACAAAACCA
TGGTTAACCATCTAAGTAAATATATGTACATTTTGTGAAACCACATCTAA
TCGAAATGTATTGCATTTGCTGCCAAGGCACAGCCCAAAAAAAAAAAAAA
AA
RE10554.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:37:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ubi-p63E-RA | 2475 | Ubi-p63E-RA | 1970..2200 | 62..292 | 795 | 89.6 | Plus |
Ubi-p63E-RA | 2475 | Ubi-p63E-RA | 1514..1744 | 62..292 | 795 | 89.6 | Plus |
Ubi-p63E-RA | 2475 | Ubi-p63E-RA | 830..1060 | 62..292 | 795 | 89.6 | Plus |
Ubi-p63E.b | 2638 | Ubi-p63E.b | 1970..2200 | 62..292 | 795 | 89.6 | Plus |
Ubi-p63E.b | 2638 | Ubi-p63E.b | 1514..1744 | 62..292 | 795 | 89.6 | Plus |
Ubi-p63E.b | 2638 | Ubi-p63E.b | 830..1060 | 62..292 | 795 | 89.6 | Plus |
Ubi-p63E-RC | 2710 | Ubi-p63E-RC | 2033..2263 | 62..292 | 795 | 89.6 | Plus |
Ubi-p63E-RC | 2710 | Ubi-p63E-RC | 1577..1807 | 62..292 | 795 | 89.6 | Plus |
Ubi-p63E-RC | 2710 | Ubi-p63E-RC | 893..1123 | 62..292 | 795 | 89.6 | Plus |
Ubi-p63E-RA | 2475 | Ubi-p63E-RA | 1742..1972 | 62..292 | 765 | 88.7 | Plus |
Ubi-p63E-RA | 2475 | Ubi-p63E-RA | 1286..1516 | 62..292 | 765 | 88.7 | Plus |
Ubi-p63E-RA | 2475 | Ubi-p63E-RA | 1058..1288 | 62..292 | 765 | 88.7 | Plus |
Ubi-p63E-RA | 2475 | Ubi-p63E-RA | 602..832 | 62..292 | 765 | 88.7 | Plus |
Ubi-p63E.b | 2638 | Ubi-p63E.b | 1742..1972 | 62..292 | 765 | 88.7 | Plus |
Ubi-p63E.b | 2638 | Ubi-p63E.b | 1286..1516 | 62..292 | 765 | 88.7 | Plus |
Ubi-p63E.b | 2638 | Ubi-p63E.b | 1058..1288 | 62..292 | 765 | 88.7 | Plus |
Ubi-p63E.b | 2638 | Ubi-p63E.b | 602..832 | 62..292 | 765 | 88.7 | Plus |
Ubi-p63E-RC | 2710 | Ubi-p63E-RC | 1805..2035 | 62..292 | 765 | 88.7 | Plus |
Ubi-p63E-RC | 2710 | Ubi-p63E-RC | 1349..1579 | 62..292 | 765 | 88.7 | Plus |
Ubi-p63E-RC | 2710 | Ubi-p63E-RC | 1121..1351 | 62..292 | 765 | 88.7 | Plus |
Ubi-p63E-RC | 2710 | Ubi-p63E-RC | 665..895 | 62..292 | 765 | 88.7 | Plus |
Ubi-p63E-RA | 2475 | Ubi-p63E-RA | 2198..2429 | 62..293 | 755 | 88.3 | Plus |
Ubi-p63E.b | 2638 | Ubi-p63E.b | 2198..2429 | 62..293 | 755 | 88.3 | Plus |
Ubi-p63E-RC | 2710 | Ubi-p63E-RC | 2261..2492 | 62..293 | 755 | 88.3 | Plus |
Ubi-p63E-RA | 2475 | Ubi-p63E-RA | 374..604 | 62..292 | 750 | 88.3 | Plus |
Ubi-p63E.b | 2638 | Ubi-p63E.b | 374..604 | 62..292 | 750 | 88.3 | Plus |
Ubi-p63E-RC | 2710 | Ubi-p63E-RC | 437..667 | 62..292 | 750 | 88.3 | Plus |
Ubi-p63E-RA | 2475 | Ubi-p63E-RA | 147..376 | 63..292 | 730 | 87.8 | Plus |
Ubi-p63E.b | 2638 | Ubi-p63E.b | 147..376 | 63..292 | 730 | 87.8 | Plus |
Ubi-p63E-RC | 2710 | Ubi-p63E-RC | 210..439 | 63..292 | 730 | 87.8 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:45:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 4227191..4227727 | 49..585 | 2685 | 100 | Plus |
chr3L | 24539361 | chr3L | 3899161..3899391 | 292..62 | 795 | 89.6 | Minus |
chr3L | 24539361 | chr3L | 3899617..3899847 | 292..62 | 795 | 89.6 | Minus |
chr3L | 24539361 | chr3L | 3900301..3900531 | 292..62 | 795 | 89.6 | Minus |
chr3L | 24539361 | chr3L | 3900529..3900759 | 292..62 | 765 | 88.7 | Minus |
chr3L | 24539361 | chr3L | 3899389..3899619 | 292..62 | 765 | 88.7 | Minus |
chr3L | 24539361 | chr3L | 3899845..3900075 | 292..62 | 765 | 88.7 | Minus |
chr3L | 24539361 | chr3L | 3900073..3900303 | 292..62 | 765 | 88.7 | Minus |
chrX | 22417052 | chrX | 6170473..6170699 | 289..63 | 760 | 89 | Minus |
chr3L | 24539361 | chr3L | 3898932..3899163 | 293..62 | 755 | 88.4 | Minus |
chr3L | 24539361 | chr3L | 3900757..3900987 | 292..62 | 750 | 88.3 | Minus |
chrX | 22417052 | chrX | 6170701..6170928 | 289..62 | 735 | 88.2 | Minus |
chr3L | 24539361 | chr3L | 3900985..3901214 | 292..63 | 730 | 87.8 | Minus |
chrX | 22417052 | chrX | 6169333..6169559 | 289..63 | 730 | 88.1 | Minus |
chrX | 22417052 | chrX | 6169561..6169787 | 289..63 | 730 | 88.1 | Minus |
chrX | 22417052 | chrX | 6169789..6170015 | 289..63 | 730 | 88.1 | Minus |
chrX | 22417052 | chrX | 6170017..6170243 | 289..63 | 730 | 88.1 | Minus |
chrX | 22417052 | chrX | 6170245..6170471 | 289..63 | 730 | 88.1 | Minus |
chr2L | 23010047 | chr2L | 10408579..10408806 | 63..290 | 705 | 87.3 | Plus |
chrX | 22417052 | chrX | 6174686..6174912 | 289..63 | 655 | 85.9 | Minus |
chrX | 22417052 | chrX | 6174914..6175140 | 289..63 | 625 | 85 | Minus |
chrX | 22417052 | chrX | 6175142..6175368 | 289..63 | 625 | 85 | Minus |
chrX | 22417052 | chrX | 6174481..6174684 | 266..63 | 600 | 86.3 | Minus |
chrX | 22417052 | chrX | 6172948..6173076 | 181..53 | 270 | 80.6 | Minus |
chr2L | 23010047 | chr2L | 4226881..4226929 | 1..49 | 245 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 20:32:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CR11700-RA | 1058 | CR11700-RA | 609..835 | 63..289 | 655 | 85.9 | Plus |
CR11700-RA | 1058 | CR11700-RA | 381..607 | 63..289 | 625 | 85 | Plus |
CR11700-RA | 1058 | CR11700-RA | 153..379 | 63..289 | 625 | 85 | Plus |
CR11700-RA | 1058 | CR11700-RA | 837..1040 | 63..266 | 585 | 85.7 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:45:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 4228011..4228547 | 49..585 | 2685 | 100 | Plus |
3L | 28110227 | 3L | 3899706..3899936 | 292..62 | 795 | 89.6 | Minus |
3L | 28110227 | 3L | 3900162..3900392 | 292..62 | 795 | 89.6 | Minus |
3L | 28110227 | 3L | 3900846..3901076 | 292..62 | 795 | 89.6 | Minus |
3L | 28110227 | 3L | 3899934..3900164 | 292..62 | 765 | 88.7 | Minus |
3L | 28110227 | 3L | 3900390..3900620 | 292..62 | 765 | 88.7 | Minus |
3L | 28110227 | 3L | 3900618..3900848 | 292..62 | 765 | 88.7 | Minus |
3L | 28110227 | 3L | 3901074..3901304 | 292..62 | 765 | 88.7 | Minus |
X | 23542271 | X | 6278294..6278520 | 289..63 | 760 | 89 | Minus |
3L | 28110227 | 3L | 3899477..3899708 | 293..62 | 755 | 88.4 | Minus |
3L | 28110227 | 3L | 3901302..3901532 | 292..62 | 750 | 88.3 | Minus |
X | 23542271 | X | 6277154..6277380 | 289..63 | 745 | 88.5 | Minus |
X | 23542271 | X | 6278522..6278749 | 289..62 | 735 | 88.2 | Minus |
3L | 28110227 | 3L | 3901530..3901759 | 292..63 | 730 | 87.8 | Minus |
X | 23542271 | X | 6277382..6277608 | 289..63 | 730 | 88.1 | Minus |
X | 23542271 | X | 6277610..6277836 | 289..63 | 730 | 88.1 | Minus |
X | 23542271 | X | 6277838..6278064 | 289..63 | 730 | 88.1 | Minus |
X | 23542271 | X | 6278066..6278292 | 289..63 | 730 | 88.1 | Minus |
2L | 23513712 | 2L | 10409731..10409958 | 63..290 | 705 | 87.3 | Plus |
X | 23542271 | X | 6282501..6282727 | 289..63 | 655 | 85.9 | Minus |
X | 23542271 | X | 6282729..6282955 | 289..63 | 625 | 85 | Minus |
X | 23542271 | X | 6282957..6283183 | 289..63 | 625 | 85 | Minus |
X | 23542271 | X | 6282296..6282499 | 266..63 | 585 | 85.8 | Minus |
X | 23542271 | X | 6280764..6280892 | 181..53 | 270 | 80.6 | Minus |
2L | 23513712 | 2L | 4227701..4227749 | 1..49 | 245 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:05:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 4228011..4228547 | 49..585 | 2685 | 100 | Plus |
3L | 28103327 | 3L | 3900846..3901076 | 292..62 | 795 | 89.6 | Minus |
3L | 28103327 | 3L | 3900162..3900392 | 292..62 | 795 | 89.6 | Minus |
3L | 28103327 | 3L | 3899706..3899936 | 292..62 | 795 | 89.6 | Minus |
3L | 28103327 | 3L | 3901074..3901304 | 292..62 | 765 | 88.7 | Minus |
3L | 28103327 | 3L | 3900618..3900848 | 292..62 | 765 | 88.7 | Minus |
3L | 28103327 | 3L | 3900390..3900620 | 292..62 | 765 | 88.7 | Minus |
3L | 28103327 | 3L | 3899934..3900164 | 292..62 | 765 | 88.7 | Minus |
X | 23527363 | X | 6286392..6286618 | 289..63 | 760 | 88.9 | Minus |
3L | 28103327 | 3L | 3899477..3899708 | 293..62 | 755 | 88.3 | Minus |
3L | 28103327 | 3L | 3901302..3901532 | 292..62 | 750 | 88.3 | Minus |
X | 23527363 | X | 6285252..6285478 | 289..63 | 745 | 88.5 | Minus |
X | 23527363 | X | 6286620..6286847 | 289..62 | 735 | 88.1 | Minus |
X | 23527363 | X | 6286164..6286390 | 289..63 | 730 | 88.1 | Minus |
X | 23527363 | X | 6285936..6286162 | 289..63 | 730 | 88.1 | Minus |
X | 23527363 | X | 6285708..6285934 | 289..63 | 730 | 88.1 | Minus |
X | 23527363 | X | 6285480..6285706 | 289..63 | 730 | 88.1 | Minus |
3L | 28103327 | 3L | 3901530..3901759 | 292..63 | 730 | 87.8 | Minus |
2L | 23513712 | 2L | 10409731..10409958 | 63..290 | 705 | 87.2 | Plus |
X | 23527363 | X | 6290599..6290825 | 289..63 | 655 | 85.9 | Minus |
X | 23527363 | X | 6291055..6291281 | 289..63 | 625 | 85 | Minus |
X | 23527363 | X | 6290827..6291053 | 289..63 | 625 | 85 | Minus |
X | 23527363 | X | 6290394..6290597 | 266..63 | 585 | 85.7 | Minus |
X | 23527363 | X | 6288862..6288990 | 181..53 | 270 | 80.6 | Minus |
2L | 23513712 | 2L | 4227701..4227749 | 1..49 | 245 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 18:45:16 has no hits.
RE10554.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:46:18 Download gff for
RE10554.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 4226881..4226929 | 1..49 | 100 | -> | Plus |
chr2L | 4227192..4227727 | 50..586 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed on 2008-12-08 19:53:15 has no hits.
Sim4 to dmel-all-CDS-r5.32.fasta performed on 2011-03-16 19:01:05 has no hits.
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:16:50 Download gff for
RE10554.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL40-RA | 1..387 | 63..449 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed on 2008-07-21 19:25:42 has no hits.
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:49:27 Download gff for
RE10554.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL40-RA | 1..387 | 63..449 | 100 | | Plus |
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:32:53 has no hits.
Sim4 to dmel-all-transcript-r5.12.fasta performed on 2008-11-10 22:27:19 has no hits.
Sim4 to dmel-all-transcript-r5.32.fasta performed on 2011-03-16 19:01:05 has no hits.
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:16:50 Download gff for
RE10554.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL40-RA | 3..587 | 1..585 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-04 17:33:11 Download gff for
RE10554.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ubi-p63E-RA | 830..1060 | 62..292 | 89 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:49:27 Download gff for
RE10554.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL40-RA | 3..587 | 1..585 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:46:18 Download gff for
RE10554.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 4227701..4227749 | 1..49 | 100 | -> | Plus |
2L | 4228012..4228547 | 50..586 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:46:18 Download gff for
RE10554.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 4227701..4227749 | 1..49 | 100 | -> | Plus |
2L | 4228012..4228547 | 50..586 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:46:18 Download gff for
RE10554.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 4227701..4227749 | 1..49 | 100 | -> | Plus |
2L | 4228012..4228547 | 50..586 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:16:50 Download gff for
RE10554.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 4227701..4227749 | 1..49 | 100 | -> | Plus |
arm_2L | 4228012..4228547 | 50..586 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:01:14 Download gff for
RE10554.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 4228012..4228547 | 50..586 | 99 | | Plus |
2L | 4227701..4227749 | 1..49 | 100 | -> | Plus |
RE10554.pep Sequence
Translation from 62 to 448
> RE10554.pep
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQL
EDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRILAQKYNCDKMICRKCY
ARLHPRATNCRKKKCGHTNNLRPKKKLK*
RE10554.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:16:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF15052-PA | 128 | GF15052-PA | 1..128 | 1..128 | 671 | 100 | Plus |
Dana\GF10254-PA | 837 | GF10254-PA | 761..837 | 1..77 | 399 | 100 | Plus |
Dana\GF20300-PA | 610 | GF20300-PA | 457..533 | 1..77 | 396 | 98.7 | Plus |
Dana\GF20300-PA | 610 | GF20300-PA | 1..77 | 1..77 | 396 | 98.7 | Plus |
Dana\GF20300-PA | 610 | GF20300-PA | 77..153 | 1..77 | 396 | 98.7 | Plus |
Dana\GF20300-PA | 610 | GF20300-PA | 153..229 | 1..77 | 396 | 98.7 | Plus |
Dana\GF20300-PA | 610 | GF20300-PA | 229..305 | 1..77 | 396 | 98.7 | Plus |
Dana\GF20300-PA | 610 | GF20300-PA | 305..381 | 1..77 | 396 | 98.7 | Plus |
Dana\GF20300-PA | 610 | GF20300-PA | 381..457 | 1..77 | 396 | 98.7 | Plus |
Dana\GF10254-PA | 837 | GF10254-PA | 1..77 | 1..77 | 396 | 98.7 | Plus |
Dana\GF10254-PA | 837 | GF10254-PA | 77..153 | 1..77 | 396 | 98.7 | Plus |
Dana\GF10254-PA | 837 | GF10254-PA | 153..229 | 1..77 | 396 | 98.7 | Plus |
Dana\GF10254-PA | 837 | GF10254-PA | 229..305 | 1..77 | 396 | 98.7 | Plus |
Dana\GF10254-PA | 837 | GF10254-PA | 305..381 | 1..77 | 396 | 98.7 | Plus |
Dana\GF10254-PA | 837 | GF10254-PA | 381..457 | 1..77 | 396 | 98.7 | Plus |
Dana\GF10254-PA | 837 | GF10254-PA | 457..533 | 1..77 | 396 | 98.7 | Plus |
Dana\GF10254-PA | 837 | GF10254-PA | 533..609 | 1..77 | 396 | 98.7 | Plus |
Dana\GF10254-PA | 837 | GF10254-PA | 609..685 | 1..77 | 396 | 98.7 | Plus |
Dana\GF10254-PA | 837 | GF10254-PA | 685..761 | 1..77 | 396 | 98.7 | Plus |
Dana\GF20300-PA | 610 | GF20300-PA | 533..610 | 1..78 | 395 | 97.4 | Plus |
Dana\GF15783-PA | 156 | GF15783-PA | 1..76 | 1..76 | 391 | 100 | Plus |
Dana\GF14648-PA | 81 | GF14648-PA | 1..76 | 1..76 | 244 | 57.9 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:16:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG24988-PA | 128 | GG24988-PA | 1..128 | 1..128 | 671 | 100 | Plus |
Dere\GG17684-PA | 534 | GG17684-PA | 457..534 | 1..78 | 397 | 98.7 | Plus |
Dere\GG19855-PA | 328 | GG19855-PA | 59..135 | 1..77 | 396 | 98.7 | Plus |
Dere\GG19855-PA | 328 | GG19855-PA | 135..211 | 1..77 | 396 | 98.7 | Plus |
Dere\GG19855-PA | 328 | GG19855-PA | 211..287 | 1..77 | 396 | 98.7 | Plus |
Dere\GG17684-PA | 534 | GG17684-PA | 1..77 | 1..77 | 396 | 98.7 | Plus |
Dere\GG17684-PA | 534 | GG17684-PA | 77..153 | 1..77 | 396 | 98.7 | Plus |
Dere\GG17684-PA | 534 | GG17684-PA | 153..229 | 1..77 | 396 | 98.7 | Plus |
Dere\GG17684-PA | 534 | GG17684-PA | 229..305 | 1..77 | 396 | 98.7 | Plus |
Dere\GG17684-PA | 534 | GG17684-PA | 305..381 | 1..77 | 396 | 98.7 | Plus |
Dere\GG17684-PA | 534 | GG17684-PA | 381..457 | 1..77 | 396 | 98.7 | Plus |
Dere\GG14240-PA | 991 | GG14240-PA | 1..77 | 1..77 | 396 | 98.7 | Plus |
Dere\GG14240-PA | 991 | GG14240-PA | 77..153 | 1..77 | 396 | 98.7 | Plus |
Dere\GG14240-PA | 991 | GG14240-PA | 153..229 | 1..77 | 396 | 98.7 | Plus |
Dere\GG14240-PA | 991 | GG14240-PA | 229..305 | 1..77 | 396 | 98.7 | Plus |
Dere\GG14240-PA | 991 | GG14240-PA | 305..381 | 1..77 | 396 | 98.7 | Plus |
Dere\GG14240-PA | 991 | GG14240-PA | 381..457 | 1..77 | 396 | 98.7 | Plus |
Dere\GG14240-PA | 991 | GG14240-PA | 457..533 | 1..77 | 396 | 98.7 | Plus |
Dere\GG14240-PA | 991 | GG14240-PA | 533..609 | 1..77 | 396 | 98.7 | Plus |
Dere\GG14240-PA | 991 | GG14240-PA | 609..685 | 1..77 | 396 | 98.7 | Plus |
Dere\GG14240-PA | 991 | GG14240-PA | 685..761 | 1..77 | 396 | 98.7 | Plus |
Dere\GG14240-PA | 991 | GG14240-PA | 761..837 | 1..77 | 396 | 98.7 | Plus |
Dere\GG14240-PA | 991 | GG14240-PA | 837..913 | 1..77 | 396 | 98.7 | Plus |
Dere\GG14240-PA | 991 | GG14240-PA | 913..989 | 1..77 | 396 | 98.7 | Plus |
Dere\GG10127-PA | 156 | GG10127-PA | 1..76 | 1..76 | 391 | 100 | Plus |
Dere\GG19855-PA | 328 | GG19855-PA | 1..59 | 19..77 | 308 | 98.3 | Plus |
Dere\GG19855-PA | 328 | GG19855-PA | 287..323 | 1..37 | 162 | 89.2 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:16:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH10063-PA | 128 | GH10063-PA | 1..128 | 1..128 | 671 | 100 | Plus |
Dgri\GH15714-PA | 535 | GH15714-PA | 1..77 | 1..77 | 395 | 98.7 | Plus |
Dgri\GH15714-PA | 535 | GH15714-PA | 77..153 | 1..77 | 395 | 98.7 | Plus |
Dgri\GH15714-PA | 535 | GH15714-PA | 153..229 | 1..77 | 395 | 98.7 | Plus |
Dgri\GH15714-PA | 535 | GH15714-PA | 229..305 | 1..77 | 395 | 98.7 | Plus |
Dgri\GH15714-PA | 535 | GH15714-PA | 305..381 | 1..77 | 395 | 98.7 | Plus |
Dgri\GH15714-PA | 535 | GH15714-PA | 381..457 | 1..77 | 395 | 98.7 | Plus |
Dgri\GH12661-PA | 699 | GH12661-PA | 229..305 | 1..77 | 395 | 98.7 | Plus |
Dgri\GH12661-PA | 699 | GH12661-PA | 305..381 | 1..77 | 395 | 98.7 | Plus |
Dgri\GH12661-PA | 699 | GH12661-PA | 381..457 | 1..77 | 395 | 98.7 | Plus |
Dgri\GH12661-PA | 699 | GH12661-PA | 457..533 | 1..77 | 395 | 98.7 | Plus |
Dgri\GH12661-PA | 699 | GH12661-PA | 1..77 | 1..77 | 395 | 98.7 | Plus |
Dgri\GH12661-PA | 699 | GH12661-PA | 77..153 | 1..77 | 395 | 98.7 | Plus |
Dgri\GH12661-PA | 699 | GH12661-PA | 153..229 | 1..77 | 395 | 98.7 | Plus |
Dgri\GH15714-PA | 535 | GH15714-PA | 457..532 | 1..76 | 394 | 100 | Plus |
Dgri\GH13542-PA | 156 | GH13542-PA | 1..76 | 1..76 | 391 | 100 | Plus |
Dgri\GH12661-PA | 699 | GH12661-PA | 533..597 | 1..65 | 336 | 100 | Plus |
Dgri\GH11603-PA | 81 | GH11603-PA | 1..76 | 1..76 | 245 | 57.9 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL40-PB | 128 | CG2960-PB | 1..128 | 1..128 | 670 | 100 | Plus |
RpL40-PA | 128 | CG2960-PA | 1..128 | 1..128 | 670 | 100 | Plus |
Ubi-p63E-PD | 763 | CG11624-PD | 685..761 | 1..77 | 385 | 100 | Plus |
Ubi-p63E-PB | 763 | CG11624-PB | 685..761 | 1..77 | 385 | 100 | Plus |
Ubi-p63E-PC | 763 | CG11624-PC | 685..761 | 1..77 | 385 | 100 | Plus |
Ubi-p63E-PA | 763 | CG11624-PA | 685..761 | 1..77 | 385 | 100 | Plus |
Ubi-p5E-PB | 534 | CG32744-PB | 457..534 | 1..78 | 384 | 98.7 | Plus |
Ubi-p5E-PA | 534 | CG32744-PA | 457..534 | 1..78 | 384 | 98.7 | Plus |
Ubi-p5E-PB | 534 | CG32744-PB | 1..77 | 1..77 | 382 | 98.7 | Plus |
Ubi-p5E-PB | 534 | CG32744-PB | 77..153 | 1..77 | 382 | 98.7 | Plus |
Ubi-p5E-PB | 534 | CG32744-PB | 153..229 | 1..77 | 382 | 98.7 | Plus |
Ubi-p5E-PB | 534 | CG32744-PB | 229..305 | 1..77 | 382 | 98.7 | Plus |
Ubi-p5E-PB | 534 | CG32744-PB | 305..381 | 1..77 | 382 | 98.7 | Plus |
Ubi-p5E-PB | 534 | CG32744-PB | 381..457 | 1..77 | 382 | 98.7 | Plus |
Ubi-p5E-PA | 534 | CG32744-PA | 229..305 | 1..77 | 382 | 98.7 | Plus |
Ubi-p5E-PA | 534 | CG32744-PA | 305..381 | 1..77 | 382 | 98.7 | Plus |
Ubi-p5E-PA | 534 | CG32744-PA | 381..457 | 1..77 | 382 | 98.7 | Plus |
Ubi-p5E-PA | 534 | CG32744-PA | 1..77 | 1..77 | 382 | 98.7 | Plus |
Ubi-p5E-PA | 534 | CG32744-PA | 77..153 | 1..77 | 382 | 98.7 | Plus |
Ubi-p5E-PA | 534 | CG32744-PA | 153..229 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PD | 763 | CG11624-PD | 381..457 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PD | 763 | CG11624-PD | 457..533 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PD | 763 | CG11624-PD | 533..609 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PD | 763 | CG11624-PD | 609..685 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PD | 763 | CG11624-PD | 1..77 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PD | 763 | CG11624-PD | 77..153 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PD | 763 | CG11624-PD | 153..229 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PD | 763 | CG11624-PD | 305..381 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PD | 763 | CG11624-PD | 229..305 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PB | 763 | CG11624-PB | 1..77 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PB | 763 | CG11624-PB | 77..153 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PB | 763 | CG11624-PB | 153..229 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PB | 763 | CG11624-PB | 229..305 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PB | 763 | CG11624-PB | 305..381 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PB | 763 | CG11624-PB | 381..457 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PB | 763 | CG11624-PB | 457..533 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PB | 763 | CG11624-PB | 533..609 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PB | 763 | CG11624-PB | 609..685 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PC | 763 | CG11624-PC | 1..77 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PC | 763 | CG11624-PC | 77..153 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PC | 763 | CG11624-PC | 153..229 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PC | 763 | CG11624-PC | 229..305 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PC | 763 | CG11624-PC | 305..381 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PC | 763 | CG11624-PC | 457..533 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PC | 763 | CG11624-PC | 533..609 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PC | 763 | CG11624-PC | 609..685 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PC | 763 | CG11624-PC | 381..457 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PA | 763 | CG11624-PA | 1..77 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PA | 763 | CG11624-PA | 77..153 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PA | 763 | CG11624-PA | 153..229 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PA | 763 | CG11624-PA | 229..305 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PA | 763 | CG11624-PA | 305..381 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PA | 763 | CG11624-PA | 381..457 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PA | 763 | CG11624-PA | 457..533 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PA | 763 | CG11624-PA | 533..609 | 1..77 | 382 | 98.7 | Plus |
Ubi-p63E-PA | 763 | CG11624-PA | 609..685 | 1..77 | 382 | 98.7 | Plus |
RpS27A-PA | 156 | CG5271-PA | 1..76 | 1..76 | 381 | 100 | Plus |
CG11700-PB | 301 | CG11700-PB | 153..229 | 1..77 | 370 | 94.8 | Plus |
CG11700-PB | 301 | CG11700-PB | 1..77 | 1..77 | 336 | 87 | Plus |
CG11700-PB | 301 | CG11700-PB | 77..153 | 1..77 | 336 | 87 | Plus |
CG11700-PB | 301 | CG11700-PB | 229..296 | 1..68 | 318 | 91.2 | Plus |
Nedd8-PB | 84 | CG10679-PB | 1..76 | 1..76 | 245 | 57.9 | Plus |
Nedd8-PA | 84 | CG10679-PA | 1..76 | 1..76 | 245 | 57.9 | Plus |
park-PC | 482 | CG10523-PC | 30..102 | 1..74 | 160 | 43.2 | Plus |
park-PB | 482 | CG10523-PB | 30..102 | 1..74 | 160 | 43.2 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:16:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI16482-PA | 128 | GI16482-PA | 1..128 | 1..128 | 671 | 100 | Plus |
Dmoj\GI21526-PA | 609 | GI21526-PA | 1..77 | 1..77 | 396 | 98.7 | Plus |
Dmoj\GI21526-PA | 609 | GI21526-PA | 77..153 | 1..77 | 396 | 98.7 | Plus |
Dmoj\GI21526-PA | 609 | GI21526-PA | 153..229 | 1..77 | 396 | 98.7 | Plus |
Dmoj\GI21526-PA | 609 | GI21526-PA | 229..305 | 1..77 | 396 | 98.7 | Plus |
Dmoj\GI21526-PA | 609 | GI21526-PA | 305..381 | 1..77 | 396 | 98.7 | Plus |
Dmoj\GI21526-PA | 609 | GI21526-PA | 381..457 | 1..77 | 396 | 98.7 | Plus |
Dmoj\GI21526-PA | 609 | GI21526-PA | 457..533 | 1..77 | 396 | 98.7 | Plus |
Dmoj\GI12770-PA | 991 | GI12770-PA | 1..77 | 1..77 | 396 | 98.7 | Plus |
Dmoj\GI12770-PA | 991 | GI12770-PA | 77..153 | 1..77 | 396 | 98.7 | Plus |
Dmoj\GI12770-PA | 991 | GI12770-PA | 153..229 | 1..77 | 396 | 98.7 | Plus |
Dmoj\GI12770-PA | 991 | GI12770-PA | 229..305 | 1..77 | 396 | 98.7 | Plus |
Dmoj\GI12770-PA | 991 | GI12770-PA | 305..381 | 1..77 | 396 | 98.7 | Plus |
Dmoj\GI12770-PA | 991 | GI12770-PA | 381..457 | 1..77 | 396 | 98.7 | Plus |
Dmoj\GI12770-PA | 991 | GI12770-PA | 457..533 | 1..77 | 396 | 98.7 | Plus |
Dmoj\GI12770-PA | 991 | GI12770-PA | 533..609 | 1..77 | 396 | 98.7 | Plus |
Dmoj\GI12770-PA | 991 | GI12770-PA | 609..685 | 1..77 | 396 | 98.7 | Plus |
Dmoj\GI12770-PA | 991 | GI12770-PA | 685..761 | 1..77 | 396 | 98.7 | Plus |
Dmoj\GI12770-PA | 991 | GI12770-PA | 761..837 | 1..77 | 396 | 98.7 | Plus |
Dmoj\GI12770-PA | 991 | GI12770-PA | 837..913 | 1..77 | 396 | 98.7 | Plus |
Dmoj\GI21526-PA | 609 | GI21526-PA | 533..608 | 1..76 | 395 | 100 | Plus |
Dmoj\GI14272-PA | 668 | GI14272-PA | 1..77 | 1..77 | 395 | 98.7 | Plus |
Dmoj\GI14272-PA | 668 | GI14272-PA | 77..153 | 1..77 | 395 | 98.7 | Plus |
Dmoj\GI14272-PA | 668 | GI14272-PA | 153..229 | 1..77 | 395 | 98.7 | Plus |
Dmoj\GI14272-PA | 668 | GI14272-PA | 229..305 | 1..77 | 395 | 98.7 | Plus |
Dmoj\GI14272-PA | 668 | GI14272-PA | 305..381 | 1..77 | 395 | 98.7 | Plus |
Dmoj\GI14272-PA | 668 | GI14272-PA | 381..457 | 1..77 | 395 | 98.7 | Plus |
Dmoj\GI14272-PA | 668 | GI14272-PA | 457..533 | 1..77 | 395 | 98.7 | Plus |
Dmoj\GI12770-PA | 991 | GI12770-PA | 913..988 | 1..76 | 395 | 100 | Plus |
Dmoj\GI14272-PA | 668 | GI14272-PA | 533..608 | 1..76 | 394 | 100 | Plus |
Dmoj\GI10618-PA | 156 | GI10618-PA | 1..76 | 1..76 | 391 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:16:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL13989-PA | 128 | GL13989-PA | 1..128 | 1..128 | 671 | 100 | Plus |
Dper\GL16204-PA | 307 | GL16204-PA | 229..305 | 1..77 | 397 | 98.7 | Plus |
Dper\GL16204-PA | 307 | GL16204-PA | 1..77 | 1..77 | 395 | 98.7 | Plus |
Dper\GL16204-PA | 307 | GL16204-PA | 77..153 | 1..77 | 395 | 98.7 | Plus |
Dper\GL16204-PA | 307 | GL16204-PA | 153..229 | 1..77 | 395 | 98.7 | Plus |
Dper\GL14086-PA | 79 | GL14086-PA | 1..77 | 1..77 | 394 | 98.7 | Plus |
Dper\GL20619-PA | 231 | GL20619-PA | 1..77 | 1..77 | 394 | 98.7 | Plus |
Dper\GL20619-PA | 231 | GL20619-PA | 154..231 | 1..78 | 393 | 97.4 | Plus |
Dper\GL18966-PA | 156 | GL18966-PA | 1..76 | 1..76 | 391 | 100 | Plus |
Dper\GL20619-PA | 231 | GL20619-PA | 77..154 | 1..77 | 277 | 73.2 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:16:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA15543-PA | 128 | GA15543-PA | 1..128 | 1..128 | 671 | 100 | Plus |
Dpse\GA30006-PA | 687 | GA30006-PA | 609..685 | 1..77 | 397 | 98.7 | Plus |
Dpse\GA30006-PA | 687 | GA30006-PA | 1..77 | 1..77 | 395 | 98.7 | Plus |
Dpse\GA30006-PA | 687 | GA30006-PA | 77..153 | 1..77 | 395 | 98.7 | Plus |
Dpse\GA30006-PA | 687 | GA30006-PA | 153..229 | 1..77 | 395 | 98.7 | Plus |
Dpse\GA30006-PA | 687 | GA30006-PA | 229..305 | 1..77 | 395 | 98.7 | Plus |
Dpse\GA30006-PA | 687 | GA30006-PA | 305..381 | 1..77 | 395 | 98.7 | Plus |
Dpse\GA30006-PA | 687 | GA30006-PA | 381..457 | 1..77 | 395 | 98.7 | Plus |
Dpse\GA30006-PA | 687 | GA30006-PA | 457..533 | 1..77 | 395 | 98.7 | Plus |
Dpse\GA30006-PA | 687 | GA30006-PA | 533..609 | 1..77 | 395 | 98.7 | Plus |
Dpse\GA24218-PA | 156 | GA24218-PA | 1..76 | 1..76 | 391 | 100 | Plus |
Dpse\GA10488-PA | 80 | GA10488-PA | 1..76 | 1..76 | 245 | 57.9 | Plus |
Dpse\GA10370-PA | 471 | GA10370-PA | 16..93 | 1..79 | 152 | 39.2 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:16:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM18458-PA | 128 | GM18458-PA | 1..128 | 1..128 | 665 | 99.2 | Plus |
Dsec\GM14032-PA | 915 | GM14032-PA | 837..913 | 1..77 | 399 | 100 | Plus |
Dsec\GM12582-PA | 321 | GM12582-PA | 77..153 | 1..77 | 396 | 98.7 | Plus |
Dsec\GM12582-PA | 321 | GM12582-PA | 153..229 | 1..77 | 396 | 98.7 | Plus |
Dsec\GM12582-PA | 321 | GM12582-PA | 229..305 | 1..77 | 396 | 98.7 | Plus |
Dsec\GM14032-PA | 915 | GM14032-PA | 1..77 | 1..77 | 396 | 98.7 | Plus |
Dsec\GM14032-PA | 915 | GM14032-PA | 77..153 | 1..77 | 396 | 98.7 | Plus |
Dsec\GM14032-PA | 915 | GM14032-PA | 153..229 | 1..77 | 396 | 98.7 | Plus |
Dsec\GM14032-PA | 915 | GM14032-PA | 229..305 | 1..77 | 396 | 98.7 | Plus |
Dsec\GM14032-PA | 915 | GM14032-PA | 305..381 | 1..77 | 396 | 98.7 | Plus |
Dsec\GM14032-PA | 915 | GM14032-PA | 381..457 | 1..77 | 396 | 98.7 | Plus |
Dsec\GM14032-PA | 915 | GM14032-PA | 457..533 | 1..77 | 396 | 98.7 | Plus |
Dsec\GM14032-PA | 915 | GM14032-PA | 609..685 | 1..77 | 396 | 98.7 | Plus |
Dsec\GM14032-PA | 915 | GM14032-PA | 685..761 | 1..77 | 396 | 98.7 | Plus |
Dsec\GM18339-PA | 156 | GM18339-PA | 1..76 | 1..76 | 391 | 100 | Plus |
Dsec\GM14032-PA | 915 | GM14032-PA | 533..609 | 1..77 | 391 | 97.4 | Plus |
Dsec\GM12582-PA | 321 | GM12582-PA | 1..77 | 1..77 | 388 | 97.4 | Plus |
Dsec\GM14032-PA | 915 | GM14032-PA | 761..837 | 1..77 | 387 | 97.4 | Plus |
Dsec\GM17051-PA | 84 | GM17051-PA | 1..76 | 1..76 | 243 | 57.9 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:16:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD12014-PA | 128 | GD12014-PA | 1..128 | 1..128 | 671 | 100 | Plus |
Dsim\GD16200-PA | 105 | GD16200-PA | 1..77 | 1..77 | 398 | 100 | Plus |
Dsim\GD13313-PA | 195 | GD13313-PA | 1..77 | 1..77 | 395 | 98.7 | Plus |
Dsim\GD13313-PA | 195 | GD13313-PA | 77..153 | 1..77 | 395 | 98.7 | Plus |
Dsim\GD13314-PA | 300 | GD13314-PA | 77..153 | 1..77 | 395 | 98.7 | Plus |
Dsim\GD13314-PA | 300 | GD13314-PA | 153..229 | 1..77 | 395 | 98.7 | Plus |
Dsim\GD23696-PA | 156 | GD23696-PA | 1..76 | 1..76 | 391 | 100 | Plus |
Dsim\GD13314-PA | 300 | GD13314-PA | 1..77 | 1..77 | 386 | 96.1 | Plus |
Dsim\GD13314-PA | 300 | GD13314-PA | 229..269 | 1..41 | 209 | 100 | Plus |
Dsim\GD13313-PA | 195 | GD13313-PA | 153..192 | 1..40 | 204 | 100 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:16:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ16220-PA | 128 | GJ16220-PA | 1..128 | 1..128 | 671 | 100 | Plus |
Dvir\GJ16068-PA | 384 | GJ16068-PA | 1..77 | 1..77 | 396 | 98.7 | Plus |
Dvir\GJ16068-PA | 384 | GJ16068-PA | 77..153 | 1..77 | 396 | 98.7 | Plus |
Dvir\GJ16068-PA | 384 | GJ16068-PA | 153..229 | 1..77 | 396 | 98.7 | Plus |
Dvir\GJ16068-PA | 384 | GJ16068-PA | 229..305 | 1..77 | 396 | 98.7 | Plus |
Dvir\GJ16000-PA | 457 | GJ16000-PA | 1..77 | 1..77 | 396 | 98.7 | Plus |
Dvir\GJ16000-PA | 457 | GJ16000-PA | 77..153 | 1..77 | 396 | 98.7 | Plus |
Dvir\GJ16000-PA | 457 | GJ16000-PA | 153..229 | 1..77 | 396 | 98.7 | Plus |
Dvir\GJ16000-PA | 457 | GJ16000-PA | 229..305 | 1..77 | 396 | 98.7 | Plus |
Dvir\GJ16000-PA | 457 | GJ16000-PA | 305..381 | 1..77 | 396 | 98.7 | Plus |
Dvir\GJ16000-PA | 457 | GJ16000-PA | 381..456 | 1..76 | 394 | 100 | Plus |
Dvir\GJ21841-PA | 156 | GJ21841-PA | 1..76 | 1..76 | 391 | 100 | Plus |
Dvir\GJ17678-PA | 83 | GJ17678-PA | 1..76 | 1..76 | 244 | 57.9 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:16:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK24609-PA | 128 | GK24609-PA | 1..128 | 1..128 | 671 | 100 | Plus |
Dwil\GK10077-PA | 610 | GK10077-PA | 1..77 | 1..77 | 396 | 98.7 | Plus |
Dwil\GK10077-PA | 610 | GK10077-PA | 77..153 | 1..77 | 396 | 98.7 | Plus |
Dwil\GK10077-PA | 610 | GK10077-PA | 153..229 | 1..77 | 396 | 98.7 | Plus |
Dwil\GK10077-PA | 610 | GK10077-PA | 229..305 | 1..77 | 396 | 98.7 | Plus |
Dwil\GK10077-PA | 610 | GK10077-PA | 305..381 | 1..77 | 396 | 98.7 | Plus |
Dwil\GK10077-PA | 610 | GK10077-PA | 381..457 | 1..77 | 396 | 98.7 | Plus |
Dwil\GK10077-PA | 610 | GK10077-PA | 457..533 | 1..77 | 396 | 98.7 | Plus |
Dwil\GK10077-PA | 610 | GK10077-PA | 533..608 | 1..76 | 395 | 100 | Plus |
Dwil\GK18589-PA | 156 | GK18589-PA | 1..76 | 1..76 | 391 | 100 | Plus |
Dwil\GK20481-PA | 611 | GK20481-PA | 1..77 | 1..77 | 390 | 97.4 | Plus |
Dwil\GK20481-PA | 611 | GK20481-PA | 77..153 | 1..77 | 390 | 97.4 | Plus |
Dwil\GK20481-PA | 611 | GK20481-PA | 153..229 | 1..77 | 390 | 97.4 | Plus |
Dwil\GK20481-PA | 611 | GK20481-PA | 229..305 | 1..77 | 390 | 97.4 | Plus |
Dwil\GK20481-PA | 611 | GK20481-PA | 305..381 | 1..77 | 390 | 97.4 | Plus |
Dwil\GK20481-PA | 611 | GK20481-PA | 381..457 | 1..77 | 390 | 97.4 | Plus |
Dwil\GK20481-PA | 611 | GK20481-PA | 457..533 | 1..77 | 390 | 97.4 | Plus |
Dwil\GK20481-PA | 611 | GK20481-PA | 533..608 | 1..76 | 389 | 98.7 | Plus |
Dwil\GK24685-PA | 78 | GK24685-PA | 1..76 | 1..76 | 242 | 57.9 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:16:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\RpL40-PA | 128 | GE18276-PA | 1..128 | 1..128 | 671 | 100 | Plus |
Dyak\GE20668-PA | 79 | GE20668-PA | 1..77 | 1..77 | 398 | 100 | Plus |
Dyak\GE16472-PA | 230 | GE16472-PA | 153..230 | 1..78 | 397 | 98.7 | Plus |
Dyak\GE16472-PA | 230 | GE16472-PA | 1..77 | 1..77 | 396 | 98.7 | Plus |
Dyak\GE16472-PA | 230 | GE16472-PA | 77..153 | 1..77 | 396 | 98.7 | Plus |
Dyak\RpS27A-PA | 156 | GE11312-PA | 1..76 | 1..76 | 391 | 100 | Plus |
Dyak\GE18939-PA | 156 | GE18939-PA | 1..76 | 1..76 | 391 | 100 | Plus |
RE10554.hyp Sequence
Translation from 62 to 448
> RE10554.hyp
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQL
EDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRILAQKYNCDKMICRKCY
ARLHPRATNCRKKKCGHTNNLRPKKKLK*
RE10554.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:26:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL40-PB | 128 | CG2960-PB | 1..128 | 1..128 | 670 | 100 | Plus |
RpL40-PA | 128 | CG2960-PA | 1..128 | 1..128 | 670 | 100 | Plus |
Ubi-p5E-PB | 534 | CG32744-PB | 457..534 | 1..78 | 384 | 98.7 | Plus |
Ubi-p5E-PA | 534 | CG32744-PA | 457..534 | 1..78 | 384 | 98.7 | Plus |
Ubi-p5E-PB | 534 | CG32744-PB | 1..77 | 1..77 | 382 | 98.7 | Plus |
Ubi-p5E-PB | 534 | CG32744-PB | 77..153 | 1..77 | 382 | 98.7 | Plus |
Ubi-p5E-PB | 534 | CG32744-PB | 153..229 | 1..77 | 382 | 98.7 | Plus |
Ubi-p5E-PB | 534 | CG32744-PB | 229..305 | 1..77 | 382 | 98.7 | Plus |
Ubi-p5E-PB | 534 | CG32744-PB | 305..381 | 1..77 | 382 | 98.7 | Plus |
Ubi-p5E-PB | 534 | CG32744-PB | 381..457 | 1..77 | 382 | 98.7 | Plus |
RpS27A-PA | 156 | CG5271-PA | 1..76 | 1..76 | 381 | 100 | Plus |