Clone RE10615 Report

Search the DGRC for RE10615

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:106
Well:15
Vector:pFlc-1
Associated Gene/Transcriptor-RA
Protein status:RE10615.pep: gold
Preliminary Size:633
Sequenced Size:831

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3029 2001-12-17 Blastp of sequenced clone
CG3029 2002-01-01 Sim4 clustering to Release 2
CG3029 2003-01-01 Sim4 clustering to Release 3
or 2008-04-29 Release 5.5 accounting
or 2008-08-15 Release 5.9 accounting
or 2008-12-18 5.12 accounting

Clone Sequence Records

RE10615.complete Sequence

831 bp (831 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071026

> RE10615.complete
GGCTCGTCGAAAAAGCAAAACAGCTGGCAGTTTAAACATTTTCATTTTTT
TTGTTGACTTATCTTAGAAGTTGAGATGATAAAAGCCATTCTCGTTTTTA
ACAATCACGGGAAGCCGCGGCTATCGAAGTTCTATCAGTATTTCGATGAA
AGCCTGCAGCAACAAATAATCAAAGAGACTTTCCAATTGGTGTCCAAGCG
GGACGATAATGTTTGCAACTTTCTGGAGGGCGGAAGTTTGATTGGCGGAT
CGGATTACAAACTCATCTACAGACACTATGCCACGCTGTACTTCGTTTTC
TGCGTGGACTCCTCGGAGAGCGAACTGGGAATCCTGGACCTGATTCAGGT
GTTCGTGGAAACCCTCGACAAGTGCTTCGAAAACGTGTGTGAGCTGGACC
TGATATTCCACGCCGATGCCGTCCACCACATCCTCTCAGAACTGGTAATG
GGCGGAATGGTCCTGCAGACAAATATGAACGACATAATGGCCAGGATCGA
GGAGCAGAACAAGATCGTCAAGCAGGAAGCGGGCATCTCGGCTGCACCTG
CCCGAGCTGTGAGCGCCGTGAAGAGTATGAACATTCCGCAACAGATTAAA
GACATCAAGCTACCTGATCTGCCGCAGGCCATTAAGGACTTTAAGTTCTG
ACAAATGTGCGTCTGATATAACTCTCTCGTCTAATTGTAATCTGTTGAAT
CTAGTGCTTTTTCGCAGTCCTTCATGAATTTCCAACAGCTGTCGACTGTT
CCGTAATATTAGGTCCCACGTACTCTATATAACTCCCCTACCATAATAAA
AATGCAAATGAATTACCAAAAAAAAAAAAAA

RE10615.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
or-RA 869 or-RA 28..843 3..818 4080 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19854643..19855024 436..817 1895 99.7 Plus
chr2R 21145070 chr2R 19854385..19854589 235..439 1025 100 Plus
chr2R 21145070 chr2R 19854025..19854170 3..145 620 96.6 Plus
chr2R 21145070 chr2R 19854234..19854325 145..236 460 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:32:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:36:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23968562..23968944 436..818 1915 100 Plus
2R 25286936 2R 23968304..23968508 235..439 1025 100 Plus
2R 25286936 2R 23967947..23968089 3..145 715 100 Plus
2R 25286936 2R 23968153..23968244 145..236 460 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:04:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23969761..23970143 436..818 1915 100 Plus
2R 25260384 2R 23969503..23969707 235..439 1025 100 Plus
2R 25260384 2R 23969146..23969288 3..145 715 100 Plus
2R 25260384 2R 23969352..23969443 145..236 460 100 Plus
Blast to na_te.dros performed 2019-03-16 12:36:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dhet\Uhu 1658 Dhet\Uhu DHUHUH3 1658bp AKA(S51651) Derived from X63028 (Rel. 36, Last updated, Version 7). 1540..1599 9..65 112 70 Plus

RE10615.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:37:14 Download gff for RE10615.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19854022..19854169 1..144 95 -> Plus
chr2R 19854234..19854325 145..236 100 -> Plus
chr2R 19854387..19854589 237..439 100 -> Plus
chr2R 19854647..19855024 440..817 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:53:22 Download gff for RE10615.complete
Subject Subject Range Query Range Percent Splice Strand
or-RA 1..576 76..651 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:00:17 Download gff for RE10615.complete
Subject Subject Range Query Range Percent Splice Strand
or-RA 1..576 76..651 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:35:47 Download gff for RE10615.complete
Subject Subject Range Query Range Percent Splice Strand
or-RA 1..576 76..651 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:24:57 Download gff for RE10615.complete
Subject Subject Range Query Range Percent Splice Strand
or-RA 1..576 76..651 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:49:41 Download gff for RE10615.complete
Subject Subject Range Query Range Percent Splice Strand
or-RA 1..576 76..651 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:26:10 Download gff for RE10615.complete
Subject Subject Range Query Range Percent Splice Strand
or-RA 1..818 2..817 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:00:17 Download gff for RE10615.complete
Subject Subject Range Query Range Percent Splice Strand
or-RA 1..818 2..817 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:35:47 Download gff for RE10615.complete
Subject Subject Range Query Range Percent Splice Strand
or-RA 6..823 1..817 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:24:57 Download gff for RE10615.complete
Subject Subject Range Query Range Percent Splice Strand
or-RA 1..818 2..817 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:49:41 Download gff for RE10615.complete
Subject Subject Range Query Range Percent Splice Strand
or-RA 6..823 1..817 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:37:14 Download gff for RE10615.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23967944..23968088 1..144 98 -> Plus
2R 23968153..23968244 145..236 100 -> Plus
2R 23968306..23968508 237..439 100 -> Plus
2R 23968566..23968943 440..817 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:37:14 Download gff for RE10615.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23967944..23968088 1..144 98 -> Plus
2R 23968153..23968244 145..236 100 -> Plus
2R 23968306..23968508 237..439 100 -> Plus
2R 23968566..23968943 440..817 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:37:14 Download gff for RE10615.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23967944..23968088 1..144 98 -> Plus
2R 23968153..23968244 145..236 100 -> Plus
2R 23968306..23968508 237..439 100 -> Plus
2R 23968566..23968943 440..817 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:35:47 Download gff for RE10615.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19855467..19855611 1..144 98 -> Plus
arm_2R 19855676..19855767 145..236 100 -> Plus
arm_2R 19855829..19856031 237..439 100 -> Plus
arm_2R 19856089..19856466 440..817 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:00:18 Download gff for RE10615.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23969783..23970160 440..817 100   Plus
2R 23969161..23969305 1..144 98 -> Plus
2R 23969370..23969461 145..236 100 -> Plus
2R 23969523..23969725 237..439 100 -> Plus

RE10615.pep Sequence

Translation from 75 to 650

> RE10615.pep
MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFL
EGGSLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKC
FENVCELDLIFHADAVHHILSELVMGGMVLQTNMNDIMARIEEQNKIVKQ
EAGISAAPARAVSAVKSMNIPQQIKDIKLPDLPQAIKDFKF*

RE10615.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:13:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12884-PA 191 GF12884-PA 1..191 1..191 1007 99.5 Plus
Dana\GF17262-PA 142 GF17262-PA 1..141 1..147 260 36.7 Plus
Dana\GF17027-PA 156 GF17027-PA 4..145 5..152 251 33.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:13:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22912-PA 191 GG22912-PA 1..191 1..191 1010 100 Plus
Dere\GG14749-PA 142 GG14749-PA 1..141 1..147 260 36.7 Plus
Dere\GG11239-PA 156 GG11239-PA 4..145 5..152 251 33.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:13:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21700-PA 191 GH21700-PA 1..191 1..191 988 96.9 Plus
Dgri\GH11883-PA 156 GH11883-PA 4..145 5..152 250 33.8 Plus
Dgri\GH18926-PA 122 GH18926-PA 3..121 23..147 204 34.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:47
Subject Length Description Subject Range Query Range Score Percent Strand
or-PA 191 CG3029-PA 1..191 1..191 976 100 Plus
AP-2sigma-PA 142 CG6056-PA 1..141 1..147 269 36.7 Plus
AP-1sigma-PD 152 CG5864-PD 1..145 1..151 267 34.4 Plus
AP-1sigma-PC 157 CG5864-PC 1..146 1..152 266 34.2 Plus
AP-1sigma-PB 157 CG5864-PB 1..146 1..152 266 34.2 Plus
AP-1sigma-PA 157 CG5864-PA 1..145 1..151 262 33.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:13:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20707-PA 191 GI20707-PA 1..191 1..191 975 95.3 Plus
Dmoj\GI10836-PA 141 GI10836-PA 1..140 2..147 254 36.3 Plus
Dmoj\GI24137-PA 157 GI24137-PA 1..146 1..152 251 33.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:13:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11643-PA 191 GL11643-PA 1..191 1..191 1000 99 Plus
Dper\GL27163-PA 142 GL27163-PA 1..141 1..147 260 36.7 Plus
Dper\GL23383-PA 157 GL23383-PA 1..146 1..152 253 33.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:13:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15753-PA 191 GA15753-PA 1..191 1..191 1000 99 Plus
Dpse\GA19327-PA 142 GA19327-PA 1..141 1..147 260 36.7 Plus
Dpse\GA19188-PA 157 GA19188-PA 1..146 1..152 253 33.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:13:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16073-PA 188 GM16073-PA 1..185 1..185 979 100 Plus
Dsec\GM15088-PA 142 GM15088-PA 1..141 1..147 260 36.7 Plus
Dsec\GM26541-PA 156 GM26541-PA 4..145 5..152 251 33.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:13:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11816-PA 191 GD11816-PA 1..191 1..191 1010 100 Plus
Dsim\GD19995-PA 142 GD19995-PA 1..141 1..147 260 36.7 Plus
Dsim\GD21048-PA 156 GD21048-PA 4..145 5..152 251 33.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:13:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19697-PA 191 GJ19697-PA 1..191 1..191 971 94.2 Plus
Dvir\GJ14442-PA 142 GJ14442-PA 1..141 1..147 260 36.7 Plus
Dvir\GJ24652-PA 156 GJ24652-PA 4..145 5..152 250 33.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:13:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15725-PA 191 GK15725-PA 1..191 1..191 1002 99 Plus
Dwil\GK12771-PA 142 GK12771-PA 1..141 1..147 260 36.7 Plus
Dwil\GK11486-PA 156 GK11486-PA 4..145 5..152 251 33.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:13:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14351-PA 191 GE14351-PA 1..191 1..191 1010 100 Plus
Dyak\AP-2sigma-PA 142 GE25002-PA 1..141 1..147 260 36.7 Plus
Dyak\GE23431-PA 156 GE23431-PA 4..145 5..152 251 33.8 Plus

RE10615.hyp Sequence

Translation from 75 to 650

> RE10615.hyp
MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFL
EGGSLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKC
FENVCELDLIFHADAVHHILSELVMGGMVLQTNMNDIMARIEEQNKIVKQ
EAGISAAPARAVSAVKSMNIPQQIKDIKLPDLPQAIKDFKF*

RE10615.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:05:07
Subject Length Description Subject Range Query Range Score Percent Strand
or-PA 191 CG3029-PA 1..191 1..191 976 100 Plus
AP-2sigma-PA 142 CG6056-PA 1..141 1..147 269 36.7 Plus
AP-1sigma-PD 152 CG5864-PD 1..145 1..151 267 34.4 Plus
AP-1sigma-PC 157 CG5864-PC 1..146 1..152 266 34.2 Plus
AP-1sigma-PB 157 CG5864-PB 1..146 1..152 266 34.2 Plus