![]() | BDGP Sequence Production Resources |
Search the DGRC for RE10615
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 106 |
Well: | 15 |
Vector: | pFlc-1 |
Associated Gene/Transcript | or-RA |
Protein status: | RE10615.pep: gold |
Preliminary Size: | 633 |
Sequenced Size: | 831 |
Gene | Date | Evidence |
---|---|---|
CG3029 | 2001-12-17 | Blastp of sequenced clone |
CG3029 | 2002-01-01 | Sim4 clustering to Release 2 |
CG3029 | 2003-01-01 | Sim4 clustering to Release 3 |
or | 2008-04-29 | Release 5.5 accounting |
or | 2008-08-15 | Release 5.9 accounting |
or | 2008-12-18 | 5.12 accounting |
831 bp (831 high quality bases) assembled on 2001-12-17
GenBank Submission: AY071026
> RE10615.complete GGCTCGTCGAAAAAGCAAAACAGCTGGCAGTTTAAACATTTTCATTTTTT TTGTTGACTTATCTTAGAAGTTGAGATGATAAAAGCCATTCTCGTTTTTA ACAATCACGGGAAGCCGCGGCTATCGAAGTTCTATCAGTATTTCGATGAA AGCCTGCAGCAACAAATAATCAAAGAGACTTTCCAATTGGTGTCCAAGCG GGACGATAATGTTTGCAACTTTCTGGAGGGCGGAAGTTTGATTGGCGGAT CGGATTACAAACTCATCTACAGACACTATGCCACGCTGTACTTCGTTTTC TGCGTGGACTCCTCGGAGAGCGAACTGGGAATCCTGGACCTGATTCAGGT GTTCGTGGAAACCCTCGACAAGTGCTTCGAAAACGTGTGTGAGCTGGACC TGATATTCCACGCCGATGCCGTCCACCACATCCTCTCAGAACTGGTAATG GGCGGAATGGTCCTGCAGACAAATATGAACGACATAATGGCCAGGATCGA GGAGCAGAACAAGATCGTCAAGCAGGAAGCGGGCATCTCGGCTGCACCTG CCCGAGCTGTGAGCGCCGTGAAGAGTATGAACATTCCGCAACAGATTAAA GACATCAAGCTACCTGATCTGCCGCAGGCCATTAAGGACTTTAAGTTCTG ACAAATGTGCGTCTGATATAACTCTCTCGTCTAATTGTAATCTGTTGAAT CTAGTGCTTTTTCGCAGTCCTTCATGAATTTCCAACAGCTGTCGACTGTT CCGTAATATTAGGTCCCACGTACTCTATATAACTCCCCTACCATAATAAA AATGCAAATGAATTACCAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
or-RA | 869 | or-RA | 28..843 | 3..818 | 4080 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 19854643..19855024 | 436..817 | 1895 | 99.7 | Plus |
chr2R | 21145070 | chr2R | 19854385..19854589 | 235..439 | 1025 | 100 | Plus |
chr2R | 21145070 | chr2R | 19854025..19854170 | 3..145 | 620 | 96.6 | Plus |
chr2R | 21145070 | chr2R | 19854234..19854325 | 145..236 | 460 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 23968562..23968944 | 436..818 | 1915 | 100 | Plus |
2R | 25286936 | 2R | 23968304..23968508 | 235..439 | 1025 | 100 | Plus |
2R | 25286936 | 2R | 23967947..23968089 | 3..145 | 715 | 100 | Plus |
2R | 25286936 | 2R | 23968153..23968244 | 145..236 | 460 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 23969761..23970143 | 436..818 | 1915 | 100 | Plus |
2R | 25260384 | 2R | 23969503..23969707 | 235..439 | 1025 | 100 | Plus |
2R | 25260384 | 2R | 23969146..23969288 | 3..145 | 715 | 100 | Plus |
2R | 25260384 | 2R | 23969352..23969443 | 145..236 | 460 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dhet\Uhu | 1658 | Dhet\Uhu DHUHUH3 1658bp AKA(S51651) Derived from X63028 (Rel. 36, Last updated, Version 7). | 1540..1599 | 9..65 | 112 | 70 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 19854022..19854169 | 1..144 | 95 | -> | Plus |
chr2R | 19854234..19854325 | 145..236 | 100 | -> | Plus |
chr2R | 19854387..19854589 | 237..439 | 100 | -> | Plus |
chr2R | 19854647..19855024 | 440..817 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
or-RA | 1..576 | 76..651 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
or-RA | 1..576 | 76..651 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
or-RA | 1..576 | 76..651 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
or-RA | 1..576 | 76..651 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
or-RA | 1..576 | 76..651 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
or-RA | 1..818 | 2..817 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
or-RA | 1..818 | 2..817 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
or-RA | 6..823 | 1..817 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
or-RA | 1..818 | 2..817 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
or-RA | 6..823 | 1..817 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23967944..23968088 | 1..144 | 98 | -> | Plus |
2R | 23968153..23968244 | 145..236 | 100 | -> | Plus |
2R | 23968306..23968508 | 237..439 | 100 | -> | Plus |
2R | 23968566..23968943 | 440..817 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23967944..23968088 | 1..144 | 98 | -> | Plus |
2R | 23968153..23968244 | 145..236 | 100 | -> | Plus |
2R | 23968306..23968508 | 237..439 | 100 | -> | Plus |
2R | 23968566..23968943 | 440..817 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23967944..23968088 | 1..144 | 98 | -> | Plus |
2R | 23968153..23968244 | 145..236 | 100 | -> | Plus |
2R | 23968306..23968508 | 237..439 | 100 | -> | Plus |
2R | 23968566..23968943 | 440..817 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 19855467..19855611 | 1..144 | 98 | -> | Plus |
arm_2R | 19855676..19855767 | 145..236 | 100 | -> | Plus |
arm_2R | 19855829..19856031 | 237..439 | 100 | -> | Plus |
arm_2R | 19856089..19856466 | 440..817 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23969783..23970160 | 440..817 | 100 | Plus | |
2R | 23969161..23969305 | 1..144 | 98 | -> | Plus |
2R | 23969370..23969461 | 145..236 | 100 | -> | Plus |
2R | 23969523..23969725 | 237..439 | 100 | -> | Plus |
Translation from 75 to 650
> RE10615.pep MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFL EGGSLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKC FENVCELDLIFHADAVHHILSELVMGGMVLQTNMNDIMARIEEQNKIVKQ EAGISAAPARAVSAVKSMNIPQQIKDIKLPDLPQAIKDFKF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12884-PA | 191 | GF12884-PA | 1..191 | 1..191 | 1007 | 99.5 | Plus |
Dana\GF17262-PA | 142 | GF17262-PA | 1..141 | 1..147 | 260 | 36.7 | Plus |
Dana\GF17027-PA | 156 | GF17027-PA | 4..145 | 5..152 | 251 | 33.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22912-PA | 191 | GG22912-PA | 1..191 | 1..191 | 1010 | 100 | Plus |
Dere\GG14749-PA | 142 | GG14749-PA | 1..141 | 1..147 | 260 | 36.7 | Plus |
Dere\GG11239-PA | 156 | GG11239-PA | 4..145 | 5..152 | 251 | 33.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21700-PA | 191 | GH21700-PA | 1..191 | 1..191 | 988 | 96.9 | Plus |
Dgri\GH11883-PA | 156 | GH11883-PA | 4..145 | 5..152 | 250 | 33.8 | Plus |
Dgri\GH18926-PA | 122 | GH18926-PA | 3..121 | 23..147 | 204 | 34.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
or-PA | 191 | CG3029-PA | 1..191 | 1..191 | 976 | 100 | Plus |
AP-2sigma-PA | 142 | CG6056-PA | 1..141 | 1..147 | 269 | 36.7 | Plus |
AP-1sigma-PD | 152 | CG5864-PD | 1..145 | 1..151 | 267 | 34.4 | Plus |
AP-1sigma-PC | 157 | CG5864-PC | 1..146 | 1..152 | 266 | 34.2 | Plus |
AP-1sigma-PB | 157 | CG5864-PB | 1..146 | 1..152 | 266 | 34.2 | Plus |
AP-1sigma-PA | 157 | CG5864-PA | 1..145 | 1..151 | 262 | 33.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20707-PA | 191 | GI20707-PA | 1..191 | 1..191 | 975 | 95.3 | Plus |
Dmoj\GI10836-PA | 141 | GI10836-PA | 1..140 | 2..147 | 254 | 36.3 | Plus |
Dmoj\GI24137-PA | 157 | GI24137-PA | 1..146 | 1..152 | 251 | 33.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11643-PA | 191 | GL11643-PA | 1..191 | 1..191 | 1000 | 99 | Plus |
Dper\GL27163-PA | 142 | GL27163-PA | 1..141 | 1..147 | 260 | 36.7 | Plus |
Dper\GL23383-PA | 157 | GL23383-PA | 1..146 | 1..152 | 253 | 33.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15753-PA | 191 | GA15753-PA | 1..191 | 1..191 | 1000 | 99 | Plus |
Dpse\GA19327-PA | 142 | GA19327-PA | 1..141 | 1..147 | 260 | 36.7 | Plus |
Dpse\GA19188-PA | 157 | GA19188-PA | 1..146 | 1..152 | 253 | 33.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16073-PA | 188 | GM16073-PA | 1..185 | 1..185 | 979 | 100 | Plus |
Dsec\GM15088-PA | 142 | GM15088-PA | 1..141 | 1..147 | 260 | 36.7 | Plus |
Dsec\GM26541-PA | 156 | GM26541-PA | 4..145 | 5..152 | 251 | 33.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11816-PA | 191 | GD11816-PA | 1..191 | 1..191 | 1010 | 100 | Plus |
Dsim\GD19995-PA | 142 | GD19995-PA | 1..141 | 1..147 | 260 | 36.7 | Plus |
Dsim\GD21048-PA | 156 | GD21048-PA | 4..145 | 5..152 | 251 | 33.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ19697-PA | 191 | GJ19697-PA | 1..191 | 1..191 | 971 | 94.2 | Plus |
Dvir\GJ14442-PA | 142 | GJ14442-PA | 1..141 | 1..147 | 260 | 36.7 | Plus |
Dvir\GJ24652-PA | 156 | GJ24652-PA | 4..145 | 5..152 | 250 | 33.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15725-PA | 191 | GK15725-PA | 1..191 | 1..191 | 1002 | 99 | Plus |
Dwil\GK12771-PA | 142 | GK12771-PA | 1..141 | 1..147 | 260 | 36.7 | Plus |
Dwil\GK11486-PA | 156 | GK11486-PA | 4..145 | 5..152 | 251 | 33.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE14351-PA | 191 | GE14351-PA | 1..191 | 1..191 | 1010 | 100 | Plus |
Dyak\AP-2sigma-PA | 142 | GE25002-PA | 1..141 | 1..147 | 260 | 36.7 | Plus |
Dyak\GE23431-PA | 156 | GE23431-PA | 4..145 | 5..152 | 251 | 33.8 | Plus |
Translation from 75 to 650
> RE10615.hyp MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFL EGGSLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKC FENVCELDLIFHADAVHHILSELVMGGMVLQTNMNDIMARIEEQNKIVKQ EAGISAAPARAVSAVKSMNIPQQIKDIKLPDLPQAIKDFKF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
or-PA | 191 | CG3029-PA | 1..191 | 1..191 | 976 | 100 | Plus |
AP-2sigma-PA | 142 | CG6056-PA | 1..141 | 1..147 | 269 | 36.7 | Plus |
AP-1sigma-PD | 152 | CG5864-PD | 1..145 | 1..151 | 267 | 34.4 | Plus |
AP-1sigma-PC | 157 | CG5864-PC | 1..146 | 1..152 | 266 | 34.2 | Plus |
AP-1sigma-PB | 157 | CG5864-PB | 1..146 | 1..152 | 266 | 34.2 | Plus |