Clone RE10696 Report

Search the DGRC for RE10696

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:106
Well:96
Vector:pFlc-1
Associated Gene/TranscriptMgstl-RA
Protein status:RE10696.pep: gold
Sequenced Size:674

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1742 2002-01-01 Sim4 clustering to Release 2
CG1742 2002-01-09 Blastp of sequenced clone
Mgstl 2008-04-29 Release 5.5 accounting

Clone Sequence Records

RE10696.complete Sequence

674 bp (674 high quality bases) assembled on 2002-01-09

GenBank Submission: AY075452

> RE10696.complete
CATTTTATATTTCAGCGACGGCCGAGCAAGTTGTTGAATCCCAGACCAGA
CATTTTACGTACTATAAAGATAATAAAGTTATAGTTAAAACACATACAAT
GGCCAGCCCCGTGGAACTGCTAAGCCTCTCCAATCCCGTCTTCAAGAGTT
TCACCTTTTGGGTCGGAGTTTTGGTGATCAAAATGCTGCTGATGAGCCTT
CTGACAGCCATCCAGCGTTTCAAGACGAAGACCTTCGCCAACCCCGAGGA
CCTGATGTCCCCCAAGCTGAAGGTCAAGTTCGACGATCCGAACGTGGAGC
GTGTGCGCCGTGCCCACCGCAACGACCTGGAGAACATCCTGCCCTTCTTC
GCCATCGGTCTGCTCTACGTCCTGACTGATCCGGCCGCCTTTCTGGCCAT
CAACCTGTTCCGCGCCGTGGGCATCGCCCGCATCGTCCACACACTGGTCT
ACGCCGTGGTCGTGGTGCCCCAGCCTTCCCGTGCCCTCGCCTTCTTCGTG
GCCTTGGGCGCCACCGTCTACATGGCCCTGCAGGTCATCGCCTCGGCCGC
CTTCTGAGCACATAGGTCTAGTCCTTCTTGTTTTTTTTTTTAAGCATTTT
GAAATAATTTCTGAAATATAGAGTTACGCCTACCTCGGCTTTGGTGCTGT
TGGATCACAAAAAAAAAAAAAAAA

RE10696.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:39
Subject Length Description Subject Range Query Range Score Percent Strand
Mgstl-RA 711 Mgstl-RA 14..673 1..660 3300 100 Plus
Mgstl.a 1218 Mgstl.a 14..673 1..660 3300 100 Plus
Mgstl.b 894 Mgstl.b 14..673 1..660 3300 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:08:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 22224686..22225302 41..658 2710 96.3 Plus
chrX 22417052 chrX 20908835..20909264 229..658 2150 100 Plus
chrX 22417052 chrX 20908229..20908458 1..230 1150 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 20:33:04
Subject Length Description Subject Range Query Range Score Percent Strand
CR12628-RA 621 CR12628-RA 5..621 41..658 2720 96.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:08:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22226155..22226782 41..669 2765 96.3 Plus
X 23542271 X 21043678..21044109 229..660 2160 100 Plus
X 23542271 X 21043072..21043301 1..230 1150 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22226155..22226782 41..669 2775 96.3 Plus
X 23527363 X 21028770..21029201 229..660 2160 100 Plus
X 23527363 X 21028164..21028393 1..230 1150 100 Plus
Blast to na_te.dros performed on 2019-03-16 03:08:11 has no hits.

RE10696.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:09:05 Download gff for RE10696.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 22224686..22225295 41..651 96   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:53:26 Download gff for RE10696.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RA 1..459 99..557 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:54:55 Download gff for RE10696.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RA 1..459 99..557 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:42:19 Download gff for RE10696.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RA 1..459 99..557 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:37:27 Download gff for RE10696.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RA 1..459 99..557 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:31:45 Download gff for RE10696.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RA 1..459 99..557 100   Plus
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 20:33:05 Download gff for RE10696.complete
Subject Subject Range Query Range Percent Splice Strand
CR12628-RA 1..621 36..658 96   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:08:02 Download gff for RE10696.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RA 1..658 1..658 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:54:55 Download gff for RE10696.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RA 1..658 1..658 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:42:19 Download gff for RE10696.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RA 3..660 1..658 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:37:27 Download gff for RE10696.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RA 1..658 1..658 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:31:45 Download gff for RE10696.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RA 3..660 1..658 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:09:05 Download gff for RE10696.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22226155..22226771 41..658 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:09:05 Download gff for RE10696.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22226155..22226771 41..658 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:09:05 Download gff for RE10696.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22226155..22226771 41..658 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:42:19 Download gff for RE10696.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 22226155..22226771 41..658 96   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:20:18 Download gff for RE10696.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22226155..22226771 41..658 96   Plus

RE10696.pep Sequence

Translation from 98 to 556

> RE10696.pep
MASPVELLSLSNPVFKSFTFWVGVLVIKMLLMSLLTAIQRFKTKTFANPE
DLMSPKLKVKFDDPNVERVRRAHRNDLENILPFFAIGLLYVLTDPAAFLA
INLFRAVGIARIVHTLVYAVVVVPQPSRALAFFVALGATVYMALQVIASA
AF*

RE10696.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:14:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21709-PA 195 GF21709-PA 44..195 1..152 738 93.4 Plus
Dana\GF21219-PA 170 GF21219-PA 22..159 6..143 434 61.6 Plus
Dana\GF21218-PA 170 GF21218-PA 18..159 3..143 425 59.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:14:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19704-PA 195 GG19704-PA 44..195 1..152 766 98.7 Plus
Dere\GG17862-PA 165 GG17862-PA 12..154 1..143 462 61.5 Plus
Dere\GG17861-PA 167 GG17861-PA 19..163 7..150 409 56.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:14:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12207-PA 191 GH12207-PA 44..191 5..152 677 87.8 Plus
Dgri\GH24641-PA 162 GH24641-PA 1..151 5..143 449 59.6 Plus
Dgri\GH24640-PA 167 GH24640-PA 14..160 2..147 401 56.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:27
Subject Length Description Subject Range Query Range Score Percent Strand
Mgstl-PA 152 CG1742-PA 1..152 1..152 749 100 Plus
Mgstl-PC 151 CG1742-PC 5..151 6..152 614 83 Plus
Mgstl-PB 151 CG1742-PB 5..151 6..152 614 83 Plus
CG33178-PC 165 CG33178-PC 12..157 1..146 446 61 Plus
CG33178-PA 165 CG33178-PA 12..157 1..146 446 61 Plus
CG33178-PB 177 CG33178-PB 12..169 1..146 423 56.3 Plus
CG33177-PA 167 CG33177-PA 19..160 7..147 402 58.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:14:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15739-PA 150 GI15739-PA 3..150 5..152 690 89.2 Plus
Dmoj\GI21688-PA 177 GI21688-PA 16..166 5..143 444 58.9 Plus
Dmoj\GI21687-PA 159 GI21687-PA 11..155 7..150 389 53.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:14:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16397-PA 195 GL16397-PA 44..195 1..152 706 88.8 Plus
Dper\GL15178-PA 163 GL15178-PA 10..152 1..143 459 61.5 Plus
Dper\GL15177-PA 166 GL15177-PA 18..162 7..150 403 56.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:14:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14506-PA 195 GA14506-PA 44..195 1..152 706 88.8 Plus
Dpse\GA22801-PA 163 GA22801-PA 10..152 1..143 459 61.5 Plus
Dpse\GA22800-PA 166 GA22800-PA 18..162 7..150 404 56.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:14:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23058-PA 195 GM23058-PA 44..195 1..152 773 100 Plus
Dsec\GM12056-PA 165 GM12056-PA 12..154 1..143 462 61.5 Plus
Dsec\GM12055-PA 167 GM12055-PA 19..163 7..150 411 57.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:14:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17510-PA 195 GD17510-PA 44..195 1..152 768 98.7 Plus
Dsim\GD17192-PA 165 GD17192-PA 12..154 1..143 462 61.5 Plus
Dsim\GD17191-PA 167 GD17191-PA 19..163 7..150 411 57.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:14:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18600-PA 191 GJ18600-PA 51..191 12..152 659 90.1 Plus
Dvir\GJ15869-PA 162 GJ15869-PA 1..151 5..143 441 58.9 Plus
Dvir\GJ15868-PA 165 GJ15868-PA 17..161 7..150 418 57.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:14:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25033-PA 152 GK25033-PA 1..152 1..152 648 80.9 Plus
Dwil\GK16260-PA 185 GK16260-PA 28..174 9..143 426 57.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:14:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17903-PA 195 GE17903-PA 44..195 1..152 679 92.8 Plus
Dyak\GE17164-PA 165 GE17164-PA 12..154 1..143 461 61.5 Plus
Dyak\GE17163-PA 167 GE17163-PA 19..163 7..150 409 55.9 Plus

RE10696.hyp Sequence

Translation from 182 to 556

> RE10696.hyp
MLLMSLLTAIQRFKTKTFANPKDLMSPKLKVKFDDPNVERVRRAHRNDLE
NILPFFAIGLLYVLTDPAAFLAINLYRAVGIAHIVHTLVDAVVVVPQPSR
ALAFFVALGATVYMALQVIASAAF*

RE10696.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:04:40
Subject Length Description Subject Range Query Range Score Percent Strand
Mgstl-PA 152 CG1742-PA 29..152 1..124 587 96.8 Plus
Mgstl-PC 151 CG1742-PC 33..151 6..124 533 90.8 Plus
Mgstl-PB 151 CG1742-PB 33..151 6..124 533 90.8 Plus
CG33178-PC 165 CG33178-PC 40..157 1..118 348 60.2 Plus
CG33178-PA 165 CG33178-PA 40..157 1..118 348 60.2 Plus