Clone RE11282 Report

Search the DGRC for RE11282

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:112
Well:82
Vector:pFlc-1
Associated Gene/TranscriptCG30105-RA
Protein status:RE11282.pep: gold
Sequenced Size:598

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30105 2002-08-23 Blastp of sequenced clone
CG30105 2003-01-01 Sim4 clustering to Release 3
CG30105 2008-04-29 Release 5.5 accounting
CG30105 2008-08-15 Release 5.9 accounting
CG30105 2008-12-18 5.12 accounting

Clone Sequence Records

RE11282.complete Sequence

598 bp (598 high quality bases) assembled on 2002-08-23

GenBank Submission: BT001550

> RE11282.complete
GTTTACCTTTTATTTTGCGCAAAAAGTAACAATGTCAATTACTCTAGATT
TTAATGGTAAGAACTTTGCCAAGGGTAAGAATTTAGACGTGCACTACTTG
CCGGCCAAAATAGACGGCGATGGGGAAGCGAATGTAAAAAATTACTTCAA
CAACTACACACGTGAAGCAACCGAATTCGGCACAGGAATCCTGACGAACG
CCTTGCGCGGATTTCCTTTAATGGGAGAGAAGTTGAAAGTGCCCGAAGGA
TACTGCGGATTAGTTCTGCAAGAAACAGAGAAGCCCATCAGCGATACCTC
CGACCGAAAGTTGCGGCTAACTGGAGTATTTCAAGATTTTACTTACTGGA
ACTACGACAAAGTGCCGTCCAATGGCGATCCCTACCGACAGGCCCTTCCT
CTGCCGGATGTTGCTCAAGCTCTCTCGCAGCCCATTAGCGAAGAGGATTT
AGAGAAAGAAATCGCTCGTAATAAGGAAAACGTCAAGGAAAGCACGTAGT
TTTGTTTTAATCGCGCTTACCGCGTTCTATTTATTACTCCAAAATCTAAT
CCAATACATATATATCGTACATTTTATCTGGCAAAAAAAAAAAAAAAA

RE11282.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:53:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG30105-RA 767 CG30105-RA 100..687 1..588 2910 99.6 Plus
CG30105.a 498 CG30105.a 102..498 185..581 1985 100 Plus
icln-RA 913 icln-RA 829..913 588..504 395 97.6 Minus
CG30105.a 498 CG30105.a 47..103 1..57 285 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:06:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13479092..13479512 421..1 2105 100 Minus
chr2R 21145070 chr2R 13478868..13479027 581..422 800 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:33:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17592028..17592448 421..1 2105 100 Minus
2R 25286936 2R 17591797..17591963 588..422 805 98.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:12:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17593227..17593647 421..1 2105 100 Minus
2R 25260384 2R 17592996..17593162 588..422 805 98.8 Minus
Blast to na_te.dros performed on 2019-03-16 07:06:23 has no hits.

RE11282.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:07:29 Download gff for RE11282.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13478867..13479027 422..582 99 <- Minus
chr2R 13479092..13479512 1..421 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:53:57 Download gff for RE11282.complete
Subject Subject Range Query Range Percent Splice Strand
CG30105-RA 1..468 32..499 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:50:36 Download gff for RE11282.complete
Subject Subject Range Query Range Percent Splice Strand
CG30105-RA 1..468 32..499 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:21:36 Download gff for RE11282.complete
Subject Subject Range Query Range Percent Splice Strand
CG30105-RA 1..468 32..499 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:32:48 Download gff for RE11282.complete
Subject Subject Range Query Range Percent Splice Strand
CG30105-RA 1..468 32..499 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:28:15 Download gff for RE11282.complete
Subject Subject Range Query Range Percent Splice Strand
CG30105-RA 1..468 32..499 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:01:31 Download gff for RE11282.complete
Subject Subject Range Query Range Percent Splice Strand
CG30105-RA 1..580 1..580 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:50:36 Download gff for RE11282.complete
Subject Subject Range Query Range Percent Splice Strand
CG30105-RA 47..627 1..581 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:21:36 Download gff for RE11282.complete
Subject Subject Range Query Range Percent Splice Strand
CG30105-RA 62..642 1..581 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:32:48 Download gff for RE11282.complete
Subject Subject Range Query Range Percent Splice Strand
CG30105-RA 1..580 1..580 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:28:15 Download gff for RE11282.complete
Subject Subject Range Query Range Percent Splice Strand
CG30105-RA 62..642 1..581 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:07:29 Download gff for RE11282.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17591803..17591963 422..582 99 <- Minus
2R 17592028..17592448 1..421 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:07:29 Download gff for RE11282.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17591803..17591963 422..582 99 <- Minus
2R 17592028..17592448 1..421 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:07:29 Download gff for RE11282.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17591803..17591963 422..582 99 <- Minus
2R 17592028..17592448 1..421 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:21:36 Download gff for RE11282.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13479308..13479468 422..582 99 <- Minus
arm_2R 13479533..13479953 1..421 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:13:09 Download gff for RE11282.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17593227..17593647 1..421 100   Minus
2R 17593002..17593162 422..582 99 <- Minus

RE11282.hyp Sequence

Translation from 0 to 498

> RE11282.hyp
FTFYFAQKVTMSITLDFNGKNFAKGKNLDVHYLPAKIDGDGEANVKNYFN
NYTREATEFGTGILTNALRGFPLMGEKLKVPEGYCGLVLQETEKPISDTS
DRKLRLTGVFQDFTYWNYDKVPSNGDPYRQALPLPDVAQALSQPISEEDL
EKEIARNKENVKEST*

RE11282.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:20:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG30105-PA 155 CG30105-PA 1..155 11..165 817 100 Plus

RE11282.pep Sequence

Translation from 31 to 498

> RE11282.pep
MSITLDFNGKNFAKGKNLDVHYLPAKIDGDGEANVKNYFNNYTREATEFG
TGILTNALRGFPLMGEKLKVPEGYCGLVLQETEKPISDTSDRKLRLTGVF
QDFTYWNYDKVPSNGDPYRQALPLPDVAQALSQPISEEDLEKEIARNKEN
VKEST*

RE11282.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:57:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13241-PA 155 GF13241-PA 1..154 1..154 680 79.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:57:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21037-PA 155 GG21037-PA 1..154 1..154 688 83.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:57:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21812-PA 153 GH21812-PA 1..152 1..154 492 59.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG30105-PA 155 CG30105-PA 1..155 1..155 817 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:57:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20785-PA 153 GI20785-PA 1..153 1..155 471 58.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17686-PA 156 GL17686-PA 1..154 1..154 643 75.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15653-PA 156 GA15653-PA 1..154 1..154 642 74.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:57:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19965-PA 155 GM19965-PA 1..154 1..154 744 93.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:57:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25458-PA 155 GD25458-PA 1..154 1..154 753 93.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20519-PA 154 GJ20519-PA 1..153 1..155 491 60.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10666-PA 156 GK10666-PA 1..156 1..155 552 66 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:57:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13980-PA 155 GE13980-PA 1..154 1..154 701 85.7 Plus