Clone RE11283 Report

Search the DGRC for RE11283

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:112
Well:83
Vector:pFlc-1
Associated Gene/TranscriptCpr100A-RA
Protein status:RE11283.pep: gold
Preliminary Size:849
Sequenced Size:1391

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12045 2001-12-12 Blastp of sequenced clone
CG12045 2002-01-01 Sim4 clustering to Release 2
CG12045 2003-01-01 Sim4 clustering to Release 3
Cpr100A 2008-04-29 Release 5.5 accounting
Cpr100A 2008-08-15 Release 5.9 accounting
Cpr100A 2008-12-18 5.12 accounting

Clone Sequence Records

RE11283.complete Sequence

1391 bp (1391 high quality bases) assembled on 2001-12-12

GenBank Submission: AY070569

> RE11283.complete
TGAGGCAGTTAACTCCACAAATCCGTTGCCGTCGGTCCCATTTCCCTCTT
AACCGACTTGTAAGCGTAAAGGCGCGTGTGAATCCCCCTCGAGAAGAAGA
TAAAATTGTGTGCAGTTTACGCTTGACAAGGATATTCCCCACACCAAAAT
GTTCAGATTTCTTGCACTGACCACCTTGGTGGCCCTGGCTTCCAGCCAGC
ACTATCACCAGGATCCCAAAACGGCGGCCATCATCAGTGAGCAGCGTTAT
CTGTCCGGAGATGGAAAGTTCGGAGCTGCCTATGAGCAGGAGGATGGCAT
CAACTTCAAGGAGGAGACGGATGCGGATGGAACACGTCATGGCAGCTACA
GCTATCTGGATCCCACGGGCCAGAGGCGTACTATTTCGTACACAGCTGGC
AAAAATGGTTTCCAAGCTTCTGGAGATCACTTGCCCCAGGCACCACCTGC
TCCACCACAGCCCGTGCCCACAGCGGGATATCAGCCACAGCAGCAGTACC
AGCCGCAGCAGTACCAGGCTCCCGCTCCCCAGCCGCAGGCCAGTTTCCGC
AGCAATGACTACGGAGATGATGGTTCCTACGATCCCCGCTACAACGATCC
CTCTTTCGGACAGAACCAGCAGAGCTACCAGCAGCCCGCTGCCCAGCCGC
AGTACCGTCCTGCTCCCCAGCCCGCCTACAACCCACAGCCCGTGCAGCCG
CAGCAGCAGTACCAGCCTCAGTATCAGCAGCCCCAACCCCAGTATCAGCA
GCCGCAACCCCAGCAGGCGTACTACACCACCACCACCCCCAACCCACACC
GCTTTTCGCCACCCGGCAAACTGTCCCTGAACCGCACGCCCGATGGCTTC
ACCTACTCCTTCAACAAGGTATAAGCCCCACTGTCCTCCACTCAGACATT
ATGCATCTTCTTCATTAGTAGGGATCCTCTTTCTTCTTTTCCAACTTTCC
CTATCACAACTAGAACCCCTACTCTTTTCTTGACTCCATCAAACTCTCGT
GTGATATGTTTAAGAGCAATTGTATCGTACTTCCTATATGCGTACTGTTT
GTTATTAATTTATAATCCTACACAGAGAAAATTAATCGCTGCTGCCCAAT
GGGTATTGCTGATTTAAATTACAAAATATATTCAAAATATCATTTGCATA
TTTTTGAAATATGAAAAAACTCAAGAAATGTCGGCCTTTTTCTCTGTGAC
TTTCCCATTAAACTTTAATCTTTCCATTTAAGTCTTCCCAAGAAAAGAGA
AGTCAATAAACTTCGATGATGTTGAAAAATGATCAAAATTAATTTAGAAA
CTATGTTAATTTGGGCCTTGGGACGTCTGAGCAATTTGTACTATAATCGA
GTAAAAACAATATATGAAGGAAACCAAAAAAAAAAAAAAAA

RE11283.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:48:59
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr100A-RA 1465 Cpr100A-RA 91..1465 3..1377 6875 100 Plus
Cpr100A.b 2207 Cpr100A.b 245..1619 3..1377 6875 100 Plus
Cpr100A.a 1264 Cpr100A.a 522..1264 635..1377 3700 99.8 Plus
Cpr100A.a 1264 Cpr100A.a 4..539 3..538 2680 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:17:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26690649..26691621 403..1375 4745 99.2 Plus
chr3R 27901430 chr3R 26690344..26690591 161..408 1240 100 Plus
chr3R 27901430 chr3R 26689963..26690120 3..160 760 98.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:33:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:17:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30868212..30869186 403..1377 4860 99.9 Plus
3R 32079331 3R 30867907..30868154 161..408 1240 100 Plus
3R 32079331 3R 30867526..30867683 3..160 790 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 30609043..30610017 403..1377 4860 99.8 Plus
3R 31820162 3R 30608738..30608985 161..408 1240 100 Plus
3R 31820162 3R 30608357..30608514 3..160 790 100 Plus
Blast to na_te.dros performed 2019-03-16 19:17:26
Subject Length Description Subject Range Query Range Score Percent Strand
G-element 4346 G-element DMREPG 4346bp Derived from X06950 (g8427) (Rel. 16, Last updated, Version 1). 1354..1405 748..800 118 76.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6968..7060 470..561 111 59.1 Plus

RE11283.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:18:35 Download gff for RE11283.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26690655..26690887 409..641 99 == Plus
chr3R 26689960..26690120 1..160 97 -> Plus
chr3R 26690344..26690591 161..408 100 -> Plus
chr3R 26691011..26691621 765..1375 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:53:58 Download gff for RE11283.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr100A-RA 1..726 149..874 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:17:37 Download gff for RE11283.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr100A-RA 1..726 149..874 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:35:48 Download gff for RE11283.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr100A-RA 1..726 149..874 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:43:43 Download gff for RE11283.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr100A-RA 1..726 149..874 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:26:33 Download gff for RE11283.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr100A-RA 1..726 149..874 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:50:19 Download gff for RE11283.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr100A-RA 2..1376 2..1375 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:17:36 Download gff for RE11283.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr100A-RA 2..1376 2..1375 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:35:48 Download gff for RE11283.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr100A-RA 3..1378 1..1375 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:43:43 Download gff for RE11283.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr100A-RA 2..1376 2..1375 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:26:33 Download gff for RE11283.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr100A-RA 3..1378 1..1375 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:18:35 Download gff for RE11283.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30867523..30867683 1..160 98 -> Plus
3R 30867907..30868154 161..408 100 -> Plus
3R 30868218..30869184 409..1375 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:18:35 Download gff for RE11283.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30867523..30867683 1..160 98 -> Plus
3R 30867907..30868154 161..408 100 -> Plus
3R 30868218..30869184 409..1375 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:18:35 Download gff for RE11283.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30867523..30867683 1..160 98 -> Plus
3R 30867907..30868154 161..408 100 -> Plus
3R 30868218..30869184 409..1375 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:35:48 Download gff for RE11283.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26693245..26693405 1..160 98 -> Plus
arm_3R 26693629..26693876 161..408 100 -> Plus
arm_3R 26693940..26694906 409..1375 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:19:54 Download gff for RE11283.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30608738..30608985 161..408 100 -> Plus
3R 30609049..30610015 409..1375 100   Plus
3R 30608354..30608514 1..160 98 -> Plus

RE11283.pep Sequence

Translation from 148 to 873

> RE11283.pep
MFRFLALTTLVALASSQHYHQDPKTAAIISEQRYLSGDGKFGAAYEQEDG
INFKEETDADGTRHGSYSYLDPTGQRRTISYTAGKNGFQASGDHLPQAPP
APPQPVPTAGYQPQQQYQPQQYQAPAPQPQASFRSNDYGDDGSYDPRYND
PSFGQNQQSYQQPAAQPQYRPAPQPAYNPQPVQPQQQYQPQYQQPQPQYQ
QPQPQQAYYTTTTPNPHRFSPPGKLSLNRTPDGFTYSFNKV*

RE11283.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:05:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22928-PA 233 GF22928-PA 1..233 1..241 831 85.9 Plus
Dana\GF10274-PA 119 GF10274-PA 26..102 27..102 141 38.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:05:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11782-PA 239 GG11782-PA 1..239 1..241 807 86.6 Plus
Dere\GG13245-PA 121 GG13245-PA 1..99 1..102 154 30.4 Plus
Dere\GG20294-PA 126 GG20294-PA 1..113 2..111 145 32.2 Plus
Dere\GG16171-PA 119 GG16171-PA 24..119 24..120 138 37.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:05:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14220-PA 239 GH14220-PA 1..239 1..241 789 77.6 Plus
Dgri\GH16160-PA 120 GH16160-PA 1..99 1..102 153 30.4 Plus
Dgri\GH20994-PA 124 GH20994-PA 1..103 1..102 137 32.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:03
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr100A-PA 241 CG12045-PA 1..241 1..241 1324 100 Plus
Cpr97Eb-PA 235 CG15884-PA 12..206 10..208 214 34.6 Plus
Cpr97Ea-PB 363 CG6131-PB 35..230 5..206 214 32.1 Plus
Cpr97Ea-PA 366 CG6131-PA 38..233 5..206 214 32.1 Plus
Cpr47Ee-PA 369 CG13222-PA 99..340 20..210 180 28.4 Plus
CG43897-PK 502 CG43897-PK 172..357 75..222 167 31.4 Plus
CG43897-PL 500 CG43897-PL 172..355 75..222 165 30.5 Plus
CG15021-PA 420 CG15021-PA 75..203 96..231 164 34.6 Plus
CG43897-PR 446 CG43897-PR 117..301 75..222 164 30.3 Plus
CG43897-PA 462 CG43897-PA 133..317 75..222 164 30.3 Plus
CG43897-PJ 501 CG43897-PJ 172..356 75..222 164 30.3 Plus
CG43897-PC 501 CG43897-PC 172..356 75..222 164 30.3 Plus
CG43897-PB 501 CG43897-PB 172..356 75..222 164 30.3 Plus
CG10543-PD 1631 CG10543-PD 1215..1335 94..216 162 32.5 Plus
CG10543-PE 1634 CG10543-PE 1218..1338 94..216 162 32.5 Plus
CG10543-PA 1634 CG10543-PA 1218..1338 94..216 162 32.5 Plus
CG10543-PF 1635 CG10543-PF 1219..1339 94..216 162 32.5 Plus
Cpr49Aa-PB 144 CG30045-PB 10..136 6..119 161 37.8 Plus
Edg78E-PB 122 CG7673-PB 1..99 1..102 158 30.4 Plus
Edg78E-PA 122 CG7673-PA 1..99 1..102 158 30.4 Plus
Cpr78Cc-PA 119 CG7658-PA 1..119 1..119 155 34.7 Plus
CG15021-PA 420 CG15021-PA 147..288 96..230 155 32.2 Plus
CG15021-PA 420 CG15021-PA 99..226 97..222 152 36.4 Plus
Cpr49Ae-PA 134 CG8505-PA 29..116 27..103 150 40.9 Plus
Cpr49Ah-PA 190 CG8515-PA 39..160 18..121 149 33.3 Plus
CG44085-PM 864 CG44085-PM 165..298 83..220 149 31.7 Plus
CG44085-PO 2381 CG44085-PO 165..298 83..220 149 31.7 Plus
Cpr49Af-PB 126 CG8510-PB 2..126 3..123 148 31.5 Plus
Cpr49Af-PA 126 CG8510-PA 2..126 3..123 148 31.5 Plus
Cpr67Fa1-PA 134 CG7941-PA 1..128 1..126 143 29.7 Plus
Cpr67Fa2-PA 134 CG18349-PA 1..128 1..126 141 29.7 Plus
Lcp2-PB 126 CG8697-PB 1..103 1..102 140 29.8 Plus
Lcp2-PA 126 CG8697-PA 1..103 1..102 140 29.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:05:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22126-PA 233 GI22126-PA 1..233 1..241 732 82.2 Plus
Dmoj\GI13312-PA 120 GI13312-PA 1..99 1..102 155 32.4 Plus
Dmoj\GI12010-PA 117 GI12010-PA 1..105 1..106 154 35.5 Plus
Dmoj\GI20905-PA 121 GI20905-PA 1..100 1..102 153 32.4 Plus
Dmoj\GI20904-PA 119 GI20904-PA 1..100 1..102 148 32.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:05:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13522-PA 253 GL13522-PA 1..234 1..230 759 80.9 Plus
Dper\GL24679-PA 120 GL24679-PA 1..106 1..106 168 35.5 Plus
Dper\GL24590-PA 121 GL24590-PA 1..99 1..102 156 31.4 Plus
Dper\GL24678-PA 119 GL24678-PA 1..102 1..102 146 35.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:05:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11357-PA 244 GA11357-PA 1..244 1..241 792 83.5 Plus
Dpse\GA20507-PA 120 GA20507-PA 1..106 1..106 165 35.5 Plus
Dpse\GA20516-PA 121 GA20516-PA 1..99 1..102 153 30.4 Plus
Dpse\GA23947-PA 119 GA23947-PA 1..102 1..102 146 35.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:05:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12910-PA 241 GM12910-PA 1..241 1..241 1201 99.6 Plus
Dsec\GM22150-PA 122 GM22150-PA 1..99 1..102 155 30.4 Plus
Dsec\GM20688-PA 126 GM20688-PA 1..103 1..102 142 29.8 Plus
Dsec\GM22355-PA 120 GM22355-PA 18..111 19..111 140 35.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:05:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15195-PA 241 GD15195-PA 1..241 1..241 1201 99.6 Plus
Dsim\GD12126-PA 122 GD12126-PA 1..99 1..102 155 30.4 Plus
Dsim\GD14949-PA 120 GD14949-PA 18..102 19..102 140 37.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:05:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24247-PA 236 GJ24247-PA 1..236 1..241 696 82.4 Plus
Dvir\GJ12082-PA 120 GJ12082-PA 1..99 1..102 164 33.3 Plus
Dvir\GJ21116-PA 156 GJ21116-PA 22..147 1..130 152 29.2 Plus
Dvir\GJ20634-PA 126 GJ20634-PA 1..105 1..104 151 33.3 Plus
Dvir\GJ13281-PA 119 GJ13281-PA 1..110 1..111 145 32.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:05:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14160-PA 235 GK14160-PA 1..235 1..241 818 85.3 Plus
Dwil\GK20425-PA 121 GK20425-PA 1..99 1..102 158 32.4 Plus
Dwil\GK20466-PA 121 GK20466-PA 2..103 1..102 155 34 Plus
Dwil\GK22932-PA 134 GK22932-PA 28..129 26..119 145 38.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:05:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10908-PA 235 GE10908-PA 1..235 1..241 831 90.5 Plus
Dyak\GE22345-PA 121 GE22345-PA 1..99 1..102 154 30.4 Plus
Dyak\GE12454-PA 126 GE12454-PA 1..113 2..111 146 33.1 Plus
Dyak\GE22714-PA 120 GE22714-PA 4..98 5..102 138 30.6 Plus

RE11283.hyp Sequence

Translation from 148 to 873

> RE11283.hyp
MFRFLALTTLVALASSQHYHQDPKTAAIISEQRYLSGDGKFGAAYEQEDG
INFKEETDADGTRHGSYSYLDPTGQRRTISYTAGKNGFQASGDHLPQAPP
APPQPVPTAGYQPQQQYQPQQYQAPAPQPQASFRSNDYGDDGSYDPRYND
PSFGQNQQSYQQPAAQPQYRPAPQPAYNPQPVQPQQQYQPQYQQPQPQYQ
QPQPQQAYYTTTTPNPHRFSPPGKLSLNRTPDGFTYSFNKV*

RE11283.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:49:14
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr100A-PA 241 CG12045-PA 1..241 1..241 1324 100 Plus
Cpr97Eb-PA 235 CG15884-PA 12..206 10..208 214 34.6 Plus
Cpr97Ea-PB 363 CG6131-PB 35..230 5..206 214 32.1 Plus
Cpr97Ea-PA 366 CG6131-PA 38..233 5..206 214 32.1 Plus
Cpr47Ee-PA 369 CG13222-PA 99..340 20..210 180 28.4 Plus