Clone RE11339 Report

Search the DGRC for RE11339

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:113
Well:39
Vector:pFlc-1
Associated Gene/Transcriptl(3)73Ah-RA
Protein status:RE11339.pep: gold
Preliminary Size:669
Sequenced Size:1334

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4195 2001-12-14 Blastp of sequenced clone
CG4195 2002-01-01 Sim4 clustering to Release 2
CG4195 2003-01-01 Sim4 clustering to Release 3
l(3)73Ah 2008-04-29 Release 5.5 accounting
l(3)73Ah 2008-08-15 Release 5.9 accounting
l(3)73Ah 2008-12-18 5.12 accounting

Clone Sequence Records

RE11339.complete Sequence

1334 bp (1334 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071030

> RE11339.complete
GCTAGCTCACACGTACACACAATTTATTTAGTCGTGATTTCTATTTTATT
TGTTTCAAATTACAACCAAGAAGGAAACAAATCGCGACCAAAATCCGCTG
GCCACAATGCCGAGTGCCTGTACAAGCGTGCGCGAGCATTCCCACTAATC
GGAAGCGAGCGCATCCGCCGTTTTGAGCGTTTTCCGCGCGGGAGTGGGAA
ATCGAAAAGGCAAGGCAAGCCATCGGTCCGCTGCAAAATAGGGATAAATA
GGATATAGTAACGTAGTTCAGCACACAATCGGGGGGCCAGCATGGAGCGG
CGCGTGAAGCTGAAGACGATCAATCCGCACATAACGTGCAAGATCTGCGG
CGGCTACTTCATCGATGCCACCACGGTGACGGAGTGTCTGCACACATTTT
GCAAGAGTTGCCTGGTGAAGCACCTGGAGGAGAAGAAGACCTGCCCCACC
TGCGACAACATCATCCATCAGTCCCATCCCCTGCAATACATCAGCTTCGA
TCGCACCATGCAGGACATTGTGTACAAACTGGTGCCGAAACTGCAAGAAG
ATGAATCGCGCCGAGAGCGGGACTTCTACAAGAGCAGGAACATGCCGTGT
CCCAAGGATATCACGCAGAACCACGAGGACGACAACGAGAAGGTGATGGA
CGCCCACGCCGAGTCCGACTTCCATCGCCTGGACGAGCAGGTGAACGTGT
GCCTGGAGTGCATTAGCAATAACTTCAAGAACCTGCAGAGGCGATTCATT
CGCTGCAGCTCGCAGGCGACGATAACGCATCTCAAGAAGCTGGTGGCCAA
GAAGATCCTCAACGGCATCGAAAAGTACAGAGAGATCGACATACTGTGCA
ACGAGGAGCTGCTCGGCAAGGATCACACGCTGAAGTTCGTCTACGTGACG
CGCTGGCGCTTCCGGGATCCGCCGCTTCGGCTGCAGTTTCGTCCGCGGGT
CGAGCTCTAACCACTGTTTTAGTATAATGCCACAACAAATGATCTATTTT
TATAATTTATTGACAATGCGTAAATATCGTAATTAGGAGAGTCGCTAGTG
TTAGTCCCCTCGAAACCATGAGTGTATGTGTAAATGTGCATGTATAAAGT
CGTAAATATATGGTTATCCCTCCTAGAATTAAGTAACTTCCACTTCCTAA
CTCGTGTGACCCTTTTTTTGCCGCCTTCTTTGCTGCATTTGCTCATGATT
TAATCAACGTTCTCCGTTTGCAATATTTTATGTTCTCCATTTTTAGTTTG
AAATATATATGTATTTATTATTTTAATGTACAAAACACACGAATGTAAAT
AAATTTGTAATTATGTCGAAAAAAAAAAAAAAAA

RE11339.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:45:48
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)73Ah-RA 2004 l(3)73Ah-RA 660..1979 1..1320 6600 100 Plus
l(3)73Ah.a 1871 l(3)73Ah.a 623..1871 72..1320 6245 100 Plus
tra-RA 1158 tra-RA 956..1158 1320..1118 1015 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:26:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16579422..16579907 833..1318 2430 100 Plus
chr3L 24539361 chr3L 16578330..16578732 1..397 1890 98.5 Plus
chr3L 24539361 chr3L 16579020..16579305 549..834 1415 99.7 Plus
chr3L 24539361 chr3L 16578791..16578947 394..550 770 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:33:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:26:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16589647..16590134 833..1320 2440 100 Plus
3L 28110227 3L 16588561..16588957 1..397 1985 100 Plus
3L 28110227 3L 16589245..16589530 549..834 1430 100 Plus
3L 28110227 3L 16589016..16589172 394..550 770 99.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16582747..16583234 833..1320 2440 100 Plus
3L 28103327 3L 16581661..16582057 1..397 1985 100 Plus
3L 28103327 3L 16582345..16582630 549..834 1430 100 Plus
3L 28103327 3L 16582116..16582272 394..550 770 99.3 Plus
Blast to na_te.dros performed 2019-03-16 22:26:08
Subject Length Description Subject Range Query Range Score Percent Strand
412 7567 412 412 7567bp 1168..1221 1281..1227 119 70.9 Minus
Dbif\P-element_O 2986 Dbif\P-element_O P_O 2986bp Derived from X71634. 459..526 1240..1305 118 67.6 Plus
TART-A 13424 TART-A 13424bp 8763..8803 689..649 115 75.6 Minus

RE11339.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:27:07 Download gff for RE11339.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16578330..16578732 1..397 98 -> Plus
chr3L 16578795..16578947 398..550 100 -> Plus
chr3L 16579022..16579305 551..834 99 -> Plus
chr3L 16579424..16579907 835..1318 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:54:01 Download gff for RE11339.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)73Ah-RA 1..669 292..960 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:12:57 Download gff for RE11339.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)73Ah-RA 1..669 292..960 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:14:21 Download gff for RE11339.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)73Ah-RB 1..669 292..960 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:37:07 Download gff for RE11339.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)73Ah-RA 1..669 292..960 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:39:19 Download gff for RE11339.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)73Ah-RB 1..669 292..960 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:44:01 Download gff for RE11339.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)73Ah-RA 645..1962 1..1318 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:12:57 Download gff for RE11339.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)73Ah-RA 645..1962 1..1318 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:14:21 Download gff for RE11339.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)73Ah-RB 5..1322 1..1318 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:37:07 Download gff for RE11339.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)73Ah-RA 645..1962 1..1318 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:39:19 Download gff for RE11339.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)73Ah-RB 5..1322 1..1318 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:27:07 Download gff for RE11339.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16589020..16589172 398..550 100 -> Plus
3L 16589247..16589530 551..834 100 -> Plus
3L 16588561..16588957 1..397 100 -> Plus
3L 16589649..16590132 835..1318 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:27:07 Download gff for RE11339.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16589020..16589172 398..550 100 -> Plus
3L 16589247..16589530 551..834 100 -> Plus
3L 16588561..16588957 1..397 100 -> Plus
3L 16589649..16590132 835..1318 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:27:07 Download gff for RE11339.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16589020..16589172 398..550 100 -> Plus
3L 16589247..16589530 551..834 100 -> Plus
3L 16588561..16588957 1..397 100 -> Plus
3L 16589649..16590132 835..1318 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:14:21 Download gff for RE11339.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16581661..16582057 1..397 100 -> Plus
arm_3L 16582120..16582272 398..550 100 -> Plus
arm_3L 16582347..16582630 551..834 100 -> Plus
arm_3L 16582749..16583232 835..1318 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:14:42 Download gff for RE11339.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16581661..16582057 1..397 100 -> Plus
3L 16582120..16582272 398..550 100 -> Plus
3L 16582347..16582630 551..834 100 -> Plus
3L 16582749..16583232 835..1318 100   Plus

RE11339.pep Sequence

Translation from 291 to 959

> RE11339.pep
MERRVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKT
CPTCDNIIHQSHPLQYISFDRTMQDIVYKLVPKLQEDESRRERDFYKSRN
MPCPKDITQNHEDDNEKVMDAHAESDFHRLDEQVNVCLECISNNFKNLQR
RFIRCSSQATITHLKKLVAKKILNGIEKYREIDILCNEELLGKDHTLKFV
YVTRWRFRDPPLRLQFRPRVEL*

RE11339.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:20:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23921-PA 222 GF23921-PA 1..222 1..222 1172 99.1 Plus
Dana\GF11991-PA 1606 GF11991-PA 232..449 3..217 349 35.7 Plus
Dana\GF12933-PA 1371 GF12933-PA 18..218 14..217 182 26.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:20:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13566-PA 222 GG13566-PA 1..222 1..222 1176 99.5 Plus
Dere\GG22533-PA 1573 GG22533-PA 226..439 5..217 342 35.7 Plus
Dere\GG20351-PA 1387 GG20351-PA 36..232 14..217 186 27.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:20:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15918-PA 222 GH15918-PA 1..222 1..222 1172 99.1 Plus
Dgri\GH21599-PA 1357 GH21599-PA 5..220 3..217 335 35.4 Plus
Dgri\GH20310-PA 1536 GH20310-PA 27..239 6..217 205 26.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:40
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)73Ah-PA 222 CG4195-PA 1..222 1..222 1202 100 Plus
l(3)73Ah-PB 222 CG4195-PB 1..222 1..222 1202 100 Plus
Psc-PC 1601 CG3886-PC 250..465 3..217 333 35 Plus
Psc-PB 1601 CG3886-PB 250..465 3..217 333 35 Plus
Psc-PA 1601 CG3886-PA 250..465 3..217 333 35 Plus
Su(z)2-PB 1368 CG3905-PB 33..228 14..217 197 27.4 Plus
Su(z)2-PA 1368 CG3905-PA 33..228 14..217 197 27.4 Plus
Su(z)2-PC 1396 CG3905-PC 33..228 14..217 197 27.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:20:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16570-PA 222 GI16570-PA 1..222 1..222 1176 99.5 Plus
Dmoj\GI19568-PA 1552 GI19568-PA 213..428 3..217 317 35.4 Plus
Dmoj\GI19979-PA 1449 GI19979-PA 21..232 6..217 225 27.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:20:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17870-PA 222 GL17870-PA 1..222 1..222 1169 98.6 Plus
Dper\GL10594-PA 1624 GL10594-PA 270..482 3..217 348 35.8 Plus
Dper\GL11486-PA 1495 GL11486-PA 28..218 14..205 171 25.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:20:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18020-PA 222 GA18020-PA 1..222 1..222 1169 98.6 Plus
Dpse\GA17752-PA 1591 GA17752-PA 236..448 3..217 348 35.8 Plus
Dpse\GA24743-PA 1490 GA24743-PA 28..217 14..205 176 26 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:20:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25646-PA 222 GM25646-PA 1..222 1..222 1180 100 Plus
Dsec\GM20318-PA 286 GM20318-PA 174..268 3..99 269 51.5 Plus
Dsec\GM21438-PA 240 GM21438-PA 33..222 14..210 179 27.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:20:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14649-PA 222 GD14649-PA 1..222 1..222 1180 100 Plus
Dsim\GD25796-PA 324 GD25796-PA 261..321 3..63 192 50.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:20:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12822-PA 222 GJ12822-PA 1..222 1..222 1180 100 Plus
Dvir\GJ21143-PA 1561 GJ21143-PA 222..437 3..217 327 35 Plus
Dvir\GJ21231-PA 1440 GJ21231-PA 22..232 6..217 232 28.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:20:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20319-PA 222 GK20319-PA 1..222 1..222 1169 99.1 Plus
Dwil\GK20868-PA 1574 GK20868-PA 231..444 5..217 333 35.7 Plus
Dwil\GK20772-PA 1381 GK20772-PA 19..228 14..217 204 29 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:20:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19864-PA 222 GE19864-PA 1..222 1..222 1180 100 Plus
Dyak\GE13404-PA 1574 GE13404-PA 229..444 3..217 341 35.4 Plus
Dyak\GE12510-PA 1360 GE12510-PA 42..238 14..217 188 27.2 Plus

RE11339.hyp Sequence

Translation from 291 to 959

> RE11339.hyp
MERRVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKT
CPTCDNIIHQSHPLQYISFDRTMQDIVYKLVPKLQEDESRRERDFYKSRN
MPCPKDITQNHEDDNEKVMDAHAESDFHRLDEQVNVCLECISNNFKNLQR
RFIRCSSQATITHLKKLVAKKILNGIEKYREIDILCNEELLGKDHTLKFV
YVTRWRFRDPPLRLQFRPRVEL*

RE11339.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:35:06
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)73Ah-PA 222 CG4195-PA 1..222 1..222 1202 100 Plus
l(3)73Ah-PB 222 CG4195-PB 1..222 1..222 1202 100 Plus
Psc-PC 1601 CG3886-PC 250..465 3..217 333 35 Plus
Psc-PB 1601 CG3886-PB 250..465 3..217 333 35 Plus
Psc-PA 1601 CG3886-PA 250..465 3..217 333 35 Plus