Clone RE11385 Report

Search the DGRC for RE11385

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:113
Well:85
Vector:pFlc-1
Associated Gene/TranscriptGILT3-RA
Protein status:RE11385.pep: gold
Sequenced Size:787

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13822 2001-12-14 Blastp of sequenced clone
CG13822 2002-01-01 Sim4 clustering to Release 2
CG13822 2003-01-01 Sim4 clustering to Release 3
CG13822 2008-04-29 Release 5.5 accounting
CG13822 2008-08-15 Release 5.9 accounting
CG13822 2008-12-18 5.12 accounting

Clone Sequence Records

RE11385.complete Sequence

787 bp (787 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071032

> RE11385.complete
AGTTGTGTTTGGTTTGTGAGGCTGCCAAGAGCGAAAAACGAACGCGGACA
ATGAATAAAATATTTGGGCTACTGTTTACCCTGTGTCTGCTGCTCGTTTG
GCCCACGCCCGGAAATGGCCAGTCCCCGGATGAGTCCCGGCTCCTGGTGG
CCATTCACTACGAGGCCCTGTGCCCGGACAGCATGAGCTTCATCCGGCGC
AGATTGTACGATGCTCTGCAGGACAACGACTGGTGGTCGGTCACCGATCT
AAAGCTATATCCATTTGGCAAGGCGGGGTTCTACAACAACACATCCACTG
GCGAGAGCCAAGTATTTTGTCAGCATGGCGTGGATGAGTGCGAACTAAAT
GCACTCCATGCCTGCATTATTGAGACCCTGGACATTCGGAAGGCCTTCAA
TCTGATCTACTGCATGCTGCGCTCCTATTCGAATGAGCTGGGCCCGTGCT
CGAGGAGCATGGGTGTGGACGTCAGCAAGGCCAGGGAGTGTAAGGCATCC
CGAACCACGGCAGAAATACTGGCGCCCTACGGCAAGGAAACCCTTAAACT
GGGCATCTCCTTTGTGCCCACCATTGTGTTCGAGAATGACTTTGATCCTT
ACGACCAGAGAAGCATTCGCAACAACTTCGAAAGACACTTCTGTCGGCAG
TATCTGAAAAAGTTCAACATCAAACTGCCCACTTGTTCCGCAATTTTGTA
AACTTTTATGTAATGTACTGAGTAATTTAACTGTTTCAATGTTCCAAGAC
CAATAAACAATAATTATAACCAAAAAAAAAAAAAAAA

RE11385.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:45:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG13822-RA 880 CG13822-RA 101..873 1..773 3865 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:46:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19501279..19501589 278..588 1555 100 Plus
chr3R 27901430 chr3R 19500782..19501059 1..278 1375 99.6 Plus
chr3R 27901430 chr3R 19501662..19501845 588..771 905 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:33:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23677855..23678165 278..588 1555 100 Plus
3R 32079331 3R 23677360..23677637 1..278 1390 100 Plus
3R 32079331 3R 23678238..23678423 588..773 930 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23418686..23418996 278..588 1555 100 Plus
3R 31820162 3R 23418191..23418468 1..278 1390 100 Plus
3R 31820162 3R 23419069..23419254 588..773 930 100 Plus
Blast to na_te.dros performed 2019-03-16 18:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy9 5349 gypsy9 GYPSY9 5349bp 2964..3014 256..205 113 71.2 Minus

RE11385.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:47:44 Download gff for RE11385.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19500782..19501059 1..278 99 -> Plus
chr3R 19501280..19501588 279..587 100 -> Plus
chr3R 19501662..19501845 588..771 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:54:03 Download gff for RE11385.complete
Subject Subject Range Query Range Percent Splice Strand
CG13822-RA 1..651 51..701 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:12:50 Download gff for RE11385.complete
Subject Subject Range Query Range Percent Splice Strand
CG13822-RA 1..651 51..701 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:17:09 Download gff for RE11385.complete
Subject Subject Range Query Range Percent Splice Strand
CG13822-RA 1..651 51..701 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:37:00 Download gff for RE11385.complete
Subject Subject Range Query Range Percent Splice Strand
CG13822-RA 1..651 51..701 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:50:29 Download gff for RE11385.complete
Subject Subject Range Query Range Percent Splice Strand
GILT3-RA 1..651 51..701 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:43:42 Download gff for RE11385.complete
Subject Subject Range Query Range Percent Splice Strand
CG13822-RA 3..773 1..771 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:12:50 Download gff for RE11385.complete
Subject Subject Range Query Range Percent Splice Strand
CG13822-RA 3..773 1..771 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:17:09 Download gff for RE11385.complete
Subject Subject Range Query Range Percent Splice Strand
CG13822-RA 3..773 1..771 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:37:01 Download gff for RE11385.complete
Subject Subject Range Query Range Percent Splice Strand
CG13822-RA 3..773 1..771 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:50:29 Download gff for RE11385.complete
Subject Subject Range Query Range Percent Splice Strand
GILT3-RA 3..773 1..771 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:47:44 Download gff for RE11385.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23677360..23677637 1..278 100 -> Plus
3R 23677856..23678164 279..587 100 -> Plus
3R 23678238..23678421 588..771 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:47:44 Download gff for RE11385.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23677360..23677637 1..278 100 -> Plus
3R 23677856..23678164 279..587 100 -> Plus
3R 23678238..23678421 588..771 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:47:44 Download gff for RE11385.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23677360..23677637 1..278 100 -> Plus
3R 23677856..23678164 279..587 100 -> Plus
3R 23678238..23678421 588..771 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:17:09 Download gff for RE11385.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19503960..19504143 588..771 100   Plus
arm_3R 19503082..19503359 1..278 100 -> Plus
arm_3R 19503578..19503886 279..587 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:14:33 Download gff for RE11385.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23418191..23418468 1..278 100 -> Plus
3R 23418687..23418995 279..587 100 -> Plus
3R 23419069..23419252 588..771 100   Plus

RE11385.hyp Sequence

Translation from 2 to 700

> RE11385.hyp
LCLVCEAAKSEKRTRTMNKIFGLLFTLCLLLVWPTPGNGQSPDESRLLVA
IHYEALCPDSMSFIRRRLYDALQDNDWWSVTDLKLYPFGKAGFYNNTSTG
ESQVFCQHGVDECELNALHACIIETLDIRKAFNLIYCMLRSYSNELGPCS
RSMGVDVSKARECKASRTTAEILAPYGKETLKLGISFVPTIVFENDFDPY
DQRSIRNNFERHFCRQYLKKFNIKLPTCSAIL*

RE11385.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:43:19
Subject Length Description Subject Range Query Range Score Percent Strand
GILT3-PA 216 CG13822-PA 1..216 17..232 1161 100 Plus
GILT2-PA 207 CG10157-PA 7..206 27..228 381 38.5 Plus
CG41378-PB 228 CG41378-PB 5..195 13..194 187 28.7 Plus
CG41378-PC 196 CG41378-PC 13..163 46..194 182 31 Plus
CG41378-PD 205 CG41378-PD 22..172 46..194 182 31 Plus

RE11385.pep Sequence

Translation from 50 to 700

> RE11385.pep
MNKIFGLLFTLCLLLVWPTPGNGQSPDESRLLVAIHYEALCPDSMSFIRR
RLYDALQDNDWWSVTDLKLYPFGKAGFYNNTSTGESQVFCQHGVDECELN
ALHACIIETLDIRKAFNLIYCMLRSYSNELGPCSRSMGVDVSKARECKAS
RTTAEILAPYGKETLKLGISFVPTIVFENDFDPYDQRSIRNNFERHFCRQ
YLKKFNIKLPTCSAIL*

RE11385.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:19:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16248-PA 226 GF16248-PA 1..225 1..212 843 71.6 Plus
Dana\GF16249-PA 207 GF16249-PA 2..206 3..212 394 38.1 Plus
Dana\GF17383-PA 251 GF17383-PA 23..211 29..202 194 29.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:19:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11212-PA 218 GG11212-PA 1..218 1..215 980 86.2 Plus
Dere\GG11213-PA 207 GG11213-PA 7..207 11..213 374 37.9 Plus
Dere\GG17054-PA 250 GG17054-PA 23..209 29..199 193 27.4 Plus
Dere\GG17351-PA 209 GG17351-PA 29..207 29..215 167 28.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:19:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18523-PA 204 GH18523-PA 2..204 10..213 741 64.2 Plus
Dgri\GH14296-PA 193 GH14296-PA 13..193 27..212 376 40.3 Plus
Dgri\GH18545-PA 245 GH18545-PA 19..205 29..199 202 30 Plus
Dgri\GH19011-PA 208 GH19011-PA 1..204 4..211 156 26.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:52
Subject Length Description Subject Range Query Range Score Percent Strand
GILT3-PA 216 CG13822-PA 1..216 1..216 1161 100 Plus
GILT2-PA 207 CG10157-PA 7..206 11..212 381 38.5 Plus
CG41378-PB 228 CG41378-PB 11..195 3..178 183 28.6 Plus
CG41378-PC 196 CG41378-PC 13..163 30..178 182 31 Plus
CG41378-PD 205 CG41378-PD 22..172 30..178 182 31 Plus
CG9427-PA 213 CG9427-PA 33..211 29..215 164 28.3 Plus
CG9427-PB 212 CG9427-PB 33..210 30..215 162 28.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:19:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22060-PA 234 GI22060-PA 40..233 18..212 736 68.2 Plus
Dmoj\GI23191-PA 206 GI23191-PA 2..206 3..212 396 37.1 Plus
Dmoj\GI23244-PA 245 GI23244-PA 19..205 29..199 201 31.6 Plus
Dmoj\GI23067-PA 208 GI23067-PA 1..204 1..211 161 28.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:19:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13648-PA 224 GL13648-PA 1..223 1..212 792 67.7 Plus
Dper\GL13649-PA 210 GL13649-PA 5..209 4..212 361 34.8 Plus
Dper\GL23064-PA 250 GL23064-PA 23..237 29..216 199 28 Plus
Dper\GL22172-PA 217 GL22172-PA 10..215 1..215 162 26.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:19:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12550-PA 214 GA12550-PA 1..213 1..212 813 70.9 Plus
Dpse\GA10118-PA 210 GA10118-PA 5..209 4..212 361 34.8 Plus
Dpse\GA24052-PA 250 GA24052-PA 23..209 29..199 199 28.9 Plus
Dpse\GA22042-PA 250 GA22042-PA 23..209 29..199 199 28.9 Plus
Dpse\GA21779-PA 217 GA21779-PA 10..215 1..215 160 26.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:19:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26511-PA 216 GM26511-PA 1..216 1..216 1098 94.4 Plus
Dsec\GM26512-PA 208 GM26512-PA 3..208 6..213 374 37.4 Plus
Dsec\GM25939-PA 250 GM25939-PA 23..211 29..202 189 28 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:19:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21020-PA 172 GD21020-PA 1..172 45..216 882 95.3 Plus
Dsim\GD21021-PA 208 GD21021-PA 3..208 6..213 377 37.4 Plus
Dsim\GD20500-PA 250 GD20500-PA 23..192 29..182 184 28.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:19:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24109-PA 230 GJ24109-PA 36..229 19..212 703 64.4 Plus
Dvir\GJ14507-PA 204 GJ14507-PA 7..191 23..212 382 40 Plus
Dvir\GJ10741-PA 244 GJ10741-PA 19..205 29..199 195 30 Plus
Dvir\GJ24579-PA 209 GJ24579-PA 1..205 1..211 171 28.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:19:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13874-PA 223 GK13874-PA 33..222 24..213 745 70 Plus
Dwil\GK13875-PA 209 GK13875-PA 31..209 29..212 372 40.2 Plus
Dwil\GK13347-PA 232 GK13347-PA 22..208 29..199 194 29.5 Plus
Dwil\GK11854-PA 217 GK11854-PA 33..200 29..198 152 27 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:19:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10376-PA 472 GE10376-PA 337..472 77..212 694 93.4 Plus
Dyak\GE10377-PA 207 GE10377-PA 7..206 11..212 363 39.5 Plus
Dyak\GE24442-PA 250 GE24442-PA 23..211 29..202 184 27.5 Plus